(data stored in ACNUC7421 zone)

EMBL: CP001958.PE19

CP001958.PE19        Location/Qualifiers
FT   CDS_pept        21467..22753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0019"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="KEGG: mmi:MMAR_0768 cyclopropane-fatty-acyl-
FT                   phospholipid synthase UfaA1; PFAM:
FT                   Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96512"
FT                   /db_xref="GOA:D6Z9I5"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I5"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ADG96512.1"
FT                   /translation="MSPNPVLTQPPGLLVDAQRWPDVASVPKGPVAAIGSKVALRLLCQ
FT                   AAERFSVRLARPDGTALGTGRVAAGAPVIVVRQPDRLGRRLARHGLIGFGESYMAGEWD
FT                   SPDLVAALTALAAGMAHLVPRRLQRLRPLVLARQPKAQRNSLSQAQRNIAQHYDLSNEL
FT                   FAAFLDETMVYSSALFEQLPATQDELPEAQRRKVDRLLDLAGVRAGSRVLEIGTGWGEL
FT                   CLRAAQRGATVRSVTLSCEQRELALDRVRRAGFADQVAVDLCDYRSVDGQYDCVVSVEM
FT                   VEAVGREYWPTYFRALDRLVVPGGRVAIQAITMPHDRMLASRRTHTWVQKYIFPGGLLP
FT                   STEAISDVTARHTALRTVERTSLRPHYAQTLQLWRERFLASGDRVAALGFDHVFQRMWE
FT                   LYLAYSEAGFRSGYLDVQQWVFIREGARR"
     atgagcccga accccgttct gacgcagccc ccggggcttc tcgtcgacgc gcagcgctgg        60
     cccgacgtgg caagcgtgcc caaaggccct gtggccgcca tcggctccaa ggttgctttg       120
     aggctgttgt gccaggccgc cgagcggttc tcggtacggt tggcgcgccc ggacggcacg       180
     gcgctgggga ccgggcgggt cgcggcgggg gccccggtga tcgtcgtccg ccagcccgac       240
     cgcctgggcc gtcgtctcgc ccggcacggc ctcatcggat tcggcgagtc gtacatggcg       300
     ggggagtggg actcccccga ccttgtggcc gcgctcaccg cgctcgcggc cggcatggcg       360
     cacctggtgc cgcgccgact gcaacggctg cgcccgttgg ttttggcccg ccagccaaag       420
     gcgcagcgca acagcctgtc ccaggcccag cgcaatatcg cccagcacta cgatctgtcc       480
     aacgagctgt tcgccgcgtt cctcgacgag accatggtgt actccagcgc gctcttcgaa       540
     cagctccccg cgacccagga cgagctgccc gaagcccaac ggcgcaaagt ggaccgcctg       600
     ttggacttgg cgggcgtccg cgcggggtcg cgggtgctgg aaatcggcac cggatggggc       660
     gagctgtgcc tgcgcgccgc gcagcgcggc gcgaccgtcc gttcggtgac gctctcctgc       720
     gagcagcgcg agctcgccct cgaccgggtc cggcgggccg ggttcgccga ccaggtcgcc       780
     gtggacctgt gcgattaccg cagcgtcgac ggccaatacg actgcgtcgt gtccgtcgaa       840
     atggtggaag cggtggggcg cgagtactgg ccgacgtatt tccgcgcgct ggaccggctc       900
     gtcgtccctg gggggcgggt cgccatccag gccatcacca tgccgcacga ccggatgctc       960
     gcatcgcgcc gcacgcacac ctgggtgcag aaatatattt tccccggcgg cctgctgccg      1020
     tccaccgagg cgatctccga cgtcaccgcc cggcacaccg cgctgcgcac cgtcgagcgg      1080
     acttccttga gaccgcacta cgcccaaacc ctccagctgt ggcgcgaacg tttcctcgcc      1140
     agcggcgacc gcgtcgccgc gctcggtttc gaccacgtct tccaacggat gtgggaactg      1200
     tatctcgcct actccgaagc gggcttccga tccggttacc tcgacgtcca acaatgggtt      1260
     ttcatccgag aaggagcacg ccgatga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page