(data stored in ACNUC7421 zone)

EMBL: CP001958.PE191

CP001958.PE191       Location/Qualifiers
FT   CDS_pept        175422..177257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0195"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mav:MAV_4914 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96684"
FT                   /db_xref="GOA:D6ZAE2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE2"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADG96684.1"
FT                   /translation="MGHYKANLRDIEFNLFELFGLEETLASGDYGDLDVDAVKDILRET
FT                   RKLAEGPLADAWVGPDRNPPVYDPEKFEADLPEELQRAIKLINESGALQLCMDPELGGI
FT                   PAPRALGWASAEMLWGANAAAMFYTWGVPFAQILYDIATDEQKQWCKVIAEQNWDATMV
FT                   LTEADAGSDVGAGRTKAVEQPDGTWHIEGVKRFISGATSGDLFDNIFHLVLARPEGARA
FT                   GTKGLSLFFVPKWHYDFEKRERGERNGVFVTNLEHKMGIKASTTCELAFGQHGIPAVGW
FT                   LVGGVHDGIAQMFDVIENARMTVGIKSTATLSTGYLNALEFAKERVQGSDFTQMLNKDA
FT                   PRVTIMRHPEVRRSLLEQKAYAEGLRALYLLAAAYQDPAVAQRLFGADEDLAYRVNDFL
FT                   LPIVKGFGSEQGYAHLADSLQIFGGSGFLQDYPIEQYIRDAKIDTLYEGTTAIQSLDFF
FT                   FRKIVRDQAGALNHITGQIQEFVDSSAGNGRLKEARELLRAALGDFQATFNALAGIGFA
FT                   AMEQPTEGYKIAQSSVRFLMAAGDLLIGWLLQRQAQIAIEALDGGATGADRDFYEGKIA
FT                   SAVFFAKNILPKLASTRAIVESVDNDIMDLSDSAF"
     atgggccact acaaggcaaa cctgcgcgac atcgaattca acctcttcga gctgttcggt        60
     cttgaggaga cgctggccag cggcgattac ggcgatctcg acgtcgacgc ggtgaaggac       120
     atcctgcgcg agacccgcaa gctggccgag ggcccgctcg ccgacgcctg ggtggggccg       180
     gaccgcaacc cgccggtgta cgacccggag aagttcgagg cggacctgcc cgaggaactg       240
     caacgcgcga tcaagctcat caacgagtcc ggcgccctgc aactgtgcat ggaccccgaa       300
     ctcggcggca tccccgcgcc ccgcgcgctc ggctgggcga gcgcggagat gttgtggggg       360
     gccaacgccg ccgccatgtt ctacacctgg ggcgtgccgt tcgcccagat cctctacgac       420
     atcgccactg acgagcagaa gcagtggtgc aaggtgatcg cggagcagaa ctgggacgcg       480
     acgatggtgc tcaccgaggc cgacgcgggc tcggacgtcg gagcgggccg cacgaaggct       540
     gtcgagcagc cggacggcac ctggcacatc gagggcgtca agcgcttcat cagcggcgcg       600
     acctccggcg atcttttcga caacattttc catttggtgc tcgcgcggcc cgaaggcgcg       660
     agggcgggca cgaaggggct gtcgctcttc ttcgtcccga agtggcacta cgacttcgag       720
     aagcgcgagc gcggcgagcg caacggcgtc ttcgtgacca acctcgagca caagatgggc       780
     atcaaagcct ccaccacctg cgagctggcc ttcggccagc acggcattcc cgcagtgggc       840
     tggctggtcg gcggcgtcca cgacggcatc gcgcaaatgt tcgacgtgat cgagaacgcc       900
     cgcatgacgg tcggcatcaa atccaccgca accctctcca cgggctacct caacgcgctg       960
     gagttcgcca aggagcgcgt gcagggctcg gacttcaccc agatgctcaa caaggacgcg      1020
     ccccgggtga ccatcatgcg ccaccccgag gtgcgccgga gcctgctgga gcaaaaggcc      1080
     tacgcggaag ggctgcgcgc cctctatctg ctcgcggccg cctaccagga cccggctgtg      1140
     gcgcagcgcc tcttcggcgc ggacgaggac ctcgcctacc gggtgaacga cttcctgttg      1200
     cccatcgtca agggtttcgg ctccgagcag ggctacgcgc acctggccga cagcttgcag      1260
     atcttcggcg gctcgggctt cttgcaggac tacccgatcg agcagtacat ccgcgacgcg      1320
     aagatcgaca ccttgtacga gggcaccacg gccatccagt cgttggactt cttcttccgc      1380
     aagatcgtcc gcgaccaggc cggcgcgttg aaccacatca ccggccaaat ccaggagttc      1440
     gtggactcca gcgcgggcaa cggcaggctc aaagaggcgc gcgagctgct gcgcgccgcg      1500
     ctcggggact tccaggcgac gttcaacgcg ctcgccggga tcggcttcgc cgcgatggag      1560
     cagccgaccg agggctacaa gatcgcgcag tccagcgtcc ggttcctcat ggccgcgggc      1620
     gacctcctca tcggctggct cttgcagcgc caggcgcaga tcgccatcga agccctcgac      1680
     ggcggcgcca ccggcgccga ccgggacttc tacgagggca agatcgcctc ggcggtcttc      1740
     ttcgcgaaga acatcctgcc gaaactcgcg agcacccgcg ccatcgtcga aagtgtggac      1800
     aatgacatca tggacttgtc cgactccgcg ttctga                                1836
//

If you have problems or comments...

PBIL Back to PBIL home page