(data stored in ACNUC7421 zone)

EMBL: CP001958.PE192

CP001958.PE192       Location/Qualifiers
FT   CDS_pept        177327..179162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0196"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   msm:MSMEG_0406 acyl-CoA-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96685"
FT                   /db_xref="GOA:D6ZAE3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE3"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADG96685.1"
FT                   /translation="MGHYKANLRDIEFNLFELFGLEETLASGDYGDLDVDAVKDILRET
FT                   RKLAEGPLADTWVGPDRNPPVFDSEKHEIELPKEIAKALDLLYDSGALQVALPEEIGGI
FT                   PAPRALTWALTELLVGSHAAVYFYAIGPAFTAILYALGTDEQKQWSKVIAEQKWGATMV
FT                   LTEPDAGSDVGAGTTKAVEQPDGTWHIEGVKRFITSATSGDYFDNIFHLVLARPEGARA
FT                   GTKGLSLFFVPKWHYDFEKRERGERNGVFVTGVEHKMGIKASATCELTFGQHGKPAVGW
FT                   LVGGVHDGIAQMFDVIENARMLIGIKSIATLSTAYLNALEFAKERVQGSDFTQMLNKDA
FT                   PRVTIMRHPEVRRSLLEQKAYAEGLRALYLLAAAYQDPAVAQRLFGADEDLAYRVNDFL
FT                   LPIVKGFGSEQGYAHLADSLQIFGGSGFLQDYPIEQYIRDAKIDTLYEGTTAIQSLDFF
FT                   FRKIVRDQTAALNHITGQIQEFVDSSAGNGRLKEARELLRAALGDFQATFNALAGIGFA
FT                   AMENPTEGYKIAQSTVRFLMAAGDLLIGWLLQRQAQIAAQALDGGATGADRDFYEGKIA
FT                   SAVFFAKNILPRLASLKSIVENLDNDIMELPEAAF"
     atgggccact acaaggcaaa cctgcgcgac atcgaattca accttttcga gctgttcggt        60
     cttgaggaga cgctggccag cggcgattac ggcgatctcg acgtcgacgc ggtgaaggac       120
     atcctgcgcg agacccgcaa gctggccgag ggcccgctcg ccgacacctg ggtggggccg       180
     gaccgcaacc cgccggtctt cgactcggag aaacacgaga tcgagctgcc caaagaaatc       240
     gcgaaggcgc tcgacctcct ctacgactcc ggagcgctgc aggttgccct gcccgaggaa       300
     atcggcggca tccccgctcc ccgcgcgctc acctgggcat tgaccgagtt gctcgtcggc       360
     agccacgcgg cggtgtattt ctacgctatt ggccccgcgt tcaccgccat cctctatgcc       420
     ctcggcaccg acgagcagaa gcagtggtcc aaagtcatcg cggagcagaa gtggggagcc       480
     acgatggtgc tcaccgagcc ggacgcgggc tcggacgtcg gagccgggac cacgaaggct       540
     gtcgagcagc cggacggcac ctggcacatc gagggagtca agcgcttcat cacgagcgcg       600
     acctccggcg actacttcga caacattttc catttggtgc tcgcgcggcc cgaaggcgcg       660
     agggcgggca cgaaggggct gtcgctcttc ttcgtcccga agtggcacta cgacttcgag       720
     aagcgcgagc gcggcgagcg caacggcgtc ttcgtgacgg gcgtcgagca caagatgggc       780
     atcaaggcgt ccgccacctg cgagctgacc ttcggccagc acgggaaacc cgccgtgggc       840
     tggctggtcg gcggcgtcca cgacggcatc gcgcaaatgt tcgacgtgat cgagaacgcc       900
     cgcatgctca tcggcatcaa gagcatcgcc acgctctcca ccgcgtacct caacgcgctg       960
     gagttcgcca aggagcgcgt gcagggctcg gacttcaccc agatgctcaa caaggacgcg      1020
     ccccgggtga ccatcatgcg ccaccccgag gtgcgccgga gcctgctgga gcaaaaggcc      1080
     tacgcggaag ggctgcgcgc cctctatctg ctcgcggccg cctaccagga cccggctgtg      1140
     gcgcagcgcc tcttcggcgc ggacgaggac ctcgcctacc gggtgaacga cttcctgttg      1200
     cccatcgtca agggtttcgg ctccgagcag ggctacgcgc acctggccga cagcttgcag      1260
     atcttcggcg gctcgggctt cttgcaggac tacccgatcg agcagtacat ccgcgacgcg      1320
     aagatcgaca ccttgtacga gggcaccacg gccatccagt cgctggactt cttcttccgc      1380
     aagatcgtcc gcgaccaaac cgccgcgttg aaccacatca ccggccaaat ccaggagttc      1440
     gtggactcca gcgcgggcaa cggcaggctc aaagaggcgc gcgagctgct gcgcgccgcg      1500
     ctcggggact tccaggcgac gttcaacgcg ctcgccggga tcggcttcgc cgcgatggag      1560
     aaccccaccg agggctacaa gatcgcgcag tccaccgtcc ggttcctcat ggccgcgggc      1620
     gacctcctca tcggctggct cttgcagcgc caggcgcaga tcgccgccca ggcgctcgac      1680
     ggcggcgcca ccggcgccga ccgggacttc tacgagggca agatcgcctc ggcggtcttc      1740
     ttcgcgaaga acatcctgcc gaggctcgct tcgctcaaga gcattgtcga gaatttggac      1800
     aacgacatca tggagctccc cgaagcggcg ttctga                                1836
//

If you have problems or comments...

PBIL Back to PBIL home page