(data stored in ACNUC7421 zone)

EMBL: CP001958.PE194

CP001958.PE194       Location/Qualifiers
FT   CDS_pept        180214..181008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0198"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rha:RHA1_ro04478 ABC transporter, ATP-binding
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96687"
FT                   /db_xref="GOA:D6ZAE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96687.1"
FT                   /translation="MPDRPAEPALRFSAAALRVGERVLVENLDLALAPGEFLAVLGPNG
FT                   AGKSTLVQAALGLRALDAGSVEIFGQPPARARDHIGYLAQRVELDRATALRGRDFVGFG
FT                   YDGFRLGPGFLRAGRRKTAVARTLARLGAEDFADRPVSGLSGGEFARLRLAQALIGDPK
FT                   LLICDEPLVSLDLASQTLVVEQIVRQQQERGAAVVFITHELNPVLAHVDRVLYVARGGH
FT                   RHGPVDEVMTAASLSALYASPIDVLNVRGKLVVVGAGEEGHG"
     atgccggacc ggcccgctga gccggcgctg cggttttccg ccgcagcgct gcgcgtcggg        60
     gagcgcgtcc tggtcgagaa cctcgatctc gcgttggcgc ccggcgagtt cctcgccgtc       120
     ctcggcccca acggcgctgg caagtccaca ctggtgcaag ccgccctcgg tctgcgcgcc       180
     ctcgacgcgg gaagcgtcga gattttcggc caaccgcccg cgcgggcccg cgaccacatc       240
     gggtacctcg cccagcgggt ggagttggac cgcgcgaccg cgttgcgcgg acgcgacttc       300
     gtcggcttcg gttacgacgg gttccgcctg gggccggggt tcctgcgcgc ggggcgcaga       360
     aagaccgccg tggcgcggac gcttgccagg ctcggcgcgg aagatttcgc agaccggccc       420
     gtcagcgggc tttccggcgg ggaattcgcc cgattgcgcc tcgcccaagc cttgatcggc       480
     gacccgaagc tgctcatctg cgacgagcca ttggtgagcc tcgatctcgc gagccaaacg       540
     ttggtggtcg aacagatcgt ccgccagcag caggagcgcg gcgcggcggt cgtcttcatc       600
     acccatgagc tcaacccggt gctcgcgcat gtcgaccggg tgctgtacgt ggcgcgcggc       660
     gggcaccgcc acggtccggt ggacgaggtc atgacggcgg cgtcgctctc ggctttgtac       720
     gcgtccccga tcgacgtgct gaacgtgcgc ggcaaactcg tggtggtcgg cgcgggcgag       780
     gagggccacg gatga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page