(data stored in ACNUC7421 zone)

EMBL: CP001958.PE195

CP001958.PE195       Location/Qualifiers
FT   CDS_pept        181005..181859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0199"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: nfa:nfa4430 putative ABC
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96688"
FT                   /db_xref="GOA:D6ZAE6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE6"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADG96688.1"
FT                   /translation="MSSASFFDWGLTWHLLGYAPTRRAVLAAAILGLLSAALGPFIVQR
FT                   RMSFAVHATSELAVTGAALALFLGGSLRLGSMFGALAAGLVFGLLGLRAADRDIASGVV
FT                   LSFGLGLSVLLLNLREGAATNLSSLLTGGLASVSNDDLRLMAATAVVACLVVMCCGRPL
FT                   WFASLDPFGAAAKGVPTRSLAVGFTVLVAAAAAIGMQVVGALLVLALMVAPAAAAARLT
FT                   ASPRLGAVLAFVFAQLAAVGGVLLSLAPSWPPSALITTICFLLYMGARAVGFFRRRRFR
FT                   AAG"
     atgagttcgg cgagtttctt cgattggggg ctcacctggc acctgctcgg ctacgcgccg        60
     acgcgccgcg ccgtgctcgc cgcggcgatc ctcggcctgc tttccgccgc gctcggcccg       120
     ttcatcgtgc agcggcggat gagtttcgcc gtccacgcga ccagcgagct cgctgtgacc       180
     ggggccgctt tggcgctctt cctcggcgga tcgttgcgcc tgggctcgat gttcggggcc       240
     ctggcggccg ggctcgtgtt cgggctgctg ggtttgcggg ccgccgaccg ggatatcgcg       300
     tccggggtcg tgctctcgtt cggcctcggc ctttcggtgc tgctcttgaa cttgcgcgag       360
     ggggcggcca cgaatttgtc ctccctgttg accggcgggc tcgcgagcgt cagcaacgac       420
     gatctgcggc ttatggctgc caccgccgtt gtggcctgcc tggtggtgat gtgctgcggg       480
     cgcccgttgt ggtttgcgag cctggacccc ttcggggccg ccgcgaaggg ggtcccgaca       540
     cgctccctcg cggtcggttt cacagtgctc gtcgccgctg ctgcggcgat cgggatgcag       600
     gtcgtcgggg cgctcttggt gctcgccttg atggtcgccc ctgctgcggc agctgcccgg       660
     ctgaccgcgt cgccccgcct gggggcagtc ctcgcctttg ttttcgcgca gctcgcagcc       720
     gtgggagggg tgctgctctc gctggctccc tcgtggccgc cgtccgcgct catcaccacc       780
     atctgcttct tgctctacat gggcgcgcgg gcggtcggtt ttttccgtcg tcgccgtttt       840
     cgcgccgcag gctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page