(data stored in ACNUC7421 zone)

EMBL: CP001958.PE196

CP001958.PE196       Location/Qualifiers
FT   CDS_pept        181873..182574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c2416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96689"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96689.1"
FT                   /translation="MKNGRTFARAGWAALGAVSLPLGLASCSVLGESERFASLPEACFA
FT                   GISSAVDAAVGPLAPQGRKDDVLPEDTAISRPSGSTKFCARSFTDAVNRRDWKQGEPNF
FT                   RKVFLEYALYRSGFLSEGVDDAKRELKPPLVDPKRLVPEPNIGDEAVGWWDYSQSQGAS
FT                   WQVSLRVSNMRVLVRVSGADYLSDYTVDRQFSARLDYDSQRLKDELRREAQSIAKAVVD
FT                   QLAHPSSPGSP"
     atgaagaacg gcagaacatt cgctcgtgcc ggttgggcgg cgctgggcgc cgtgtcgctg        60
     cctctgggcc ttgcgtcgtg ctccgtgctc ggagaatcag agcggttcgc ctcgctgcca       120
     gaagcctgtt tcgcggggat ctcctctgcg gtggacgcgg cggtcgggcc gttggccccg       180
     caagggcgca aagacgatgt gttgcccgag gacacggcga tctcccggcc gtctggctcg       240
     acgaaattct gcgctcgttc gttcaccgac gccgtcaacc gcagagactg gaaacagggg       300
     gagccgaatt tccgcaaggt cttcttggag tacgccctgt atcggagcgg tttcctctca       360
     gagggggtgg acgacgcgaa acgcgagctc aaaccgccct tagtcgatcc gaagcgtctc       420
     gtgcccgagc cgaatatcgg ggacgaggcc gtcgggtggt gggactactc gcagagccaa       480
     ggcgcgagtt ggcaggtcag cctgcgggtg tccaacatgc gggtgctggt ccgggtgtcg       540
     ggcgcggact acctgagcga ctacacggtg gaccgccaat tctccgcacg gctcgattac       600
     gattcgcagc ggctcaagga cgagctgcgc cgggaagcgc agtccatcgc caaagcagtc       660
     gtcgatcagc tggcgcaccc ctcgtcgccg ggttcgccgt aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page