(data stored in ACNUC7421 zone)

EMBL: CP001958.PE197

CP001958.PE197       Location/Qualifiers
FT   CDS_pept        182673..182879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96690"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE8"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_144956"
FT                   /protein_id="ADG96690.1"
FT                   /translation="MSFGRAFAALVLLTAAAVVSVRGAHASSPQAKETGPRPAAMTEPH
FT                   IAAMTEPGGSGDGSKAGGALVPR"
     atgtctttcg gtcgagcgtt cgcggccctt gttctcctca cggccgctgc ggttgtgtcc        60
     gtgcgcggcg cccacgccag ttccccccag gccaaagaaa ccgggccacg cccggccgcg       120
     atgaccgagc cgcacatcgc cgcgatgaca gaacctggtg gcagcggcga cggttcgaag       180
     gcgggcgggg ccctcgttcc gcgctga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page