(data stored in ACNUC7421 zone)

EMBL: CP001958.PE2

CP001958.PE2         Location/Qualifiers
FT   CDS_pept        2095..3288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: mab:MAB_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96495"
FT                   /db_xref="GOA:D6Z9G8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9G8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADG96495.1"
FT                   /translation="MSEEDFTFEVPRDLFADSVSWVTRRLPARPAMPLLAGLLLSADET
FT                   GELSLGGTDYDLTAQAHLSAQVSGPGKVLVSGRLLADIAKALPSPSVRIATEGTKVHVR
FT                   SGSAKFTLPSMPVDEFPSLAEHPTPIGSAQAKELFAAISQVGVAASRDDTLPALTGLRL
FT                   VFTQEGIELAATDRFRLSVRKLVWDGKGVGEEPLTALVPAAVLSEFARTQLETDDAPVE
FT                   FALDQGAGSPSLLGVQAGPFRITTRLLDAQLPDVSQLIPKRYSSLARVELAPLVEAVRR
FT                   VSLVSARRSQIRLDFQGSGSDALLKLSAGAEEAGFAEEELAVQHWGEPISVVFNPGYLL
FT                   DGLSTFRGECGQFGFTGPNRAVALVTGDGPEPEETAEGYTADAPDQVYVLMPVRLQG"
     ttgtctgaag aagatttcac tttcgaagtg ccccgagatc tcttcgctga ttctgtctcc        60
     tgggtcaccc gtcgtctccc tgcccggccc gccatgccgt tgctcgccgg gcttttgttg       120
     tccgcggacg agaccggaga gctctcgctc ggtggcacag attatgacct caccgcccaa       180
     gcgcatcttt cggcccaggt cagcggccca gggaaggttc ttgtctctgg gcggttgctc       240
     gccgacatcg ccaaagccct gccttccccc tccgtgcgga tcgcaacgga aggcaccaaa       300
     gtgcatgtgc gcagcggttc ggcgaaattc accctgccga gcatgccggt cgacgaattc       360
     cccagcctcg cggaacatcc gacgcccatc ggctccgccc aagccaaaga gttgttcgca       420
     gcgatcagcc aggtgggcgt ggccgccagc cgggacgaca ctttgccagc gctcactggt       480
     ctgcggttgg tgttcacaca ggaagggatc gaactcgcgg ccacggaccg gttccggctc       540
     agcgtccgca agctcgtctg ggacggcaaa ggagtcggcg aagagcccct cacggcattg       600
     gtgccagcag ctgttctcag cgaattcgcc cgcacacagc tcgaaaccga cgacgcccct       660
     gtcgaattcg cgctggacca gggagccggt tcgccgagcc ttctcggcgt gcaggccggc       720
     cccttccgca tcaccacccg gttgctcgac gcccagttgc cagacgtctc ccagttgatc       780
     cccaagcggt acagctcctt ggcgagagtg gagctcgccc cgctcgtgga ggcagtgcga       840
     cgggtctcgc tggtctccgc ccggcgctca cagatccgtt tggatttcca aggctctggt       900
     tcggacgcgc tgctcaaact gtccgcaggc gcagaagaag caggtttcgc agaagaagag       960
     ctcgctgtgc agcactgggg cgagcctatt tctgtcgttt tcaaccccgg ctacttgctc      1020
     gacggcttgt ccaccttccg aggcgagtgc ggacaattcg gcttcaccgg cccgaaccga      1080
     gcagtggcat tggtgaccgg ggacggcccc gagccagaag aaactgcgga gggttacacc      1140
     gcggacgccc cggaccaggt ttacgtcttg atgccggtgc ggttgcaagg gtag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page