(data stored in ACNUC7421 zone)

EMBL: CP001958.PE20

CP001958.PE20        Location/Qualifiers
FT   CDS_pept        22750..23544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0020"
FT                   /product="protein of unknown function DUF1295"
FT                   /note="PFAM: protein of unknown function DUF1295; KEGG:
FT                   rha:RHA1_ro02561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96513"
FT                   /db_xref="GOA:D6Z9I6"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I6"
FT                   /inference="protein motif:PFAM:PF06966"
FT                   /protein_id="ADG96513.1"
FT                   /translation="MTVLHNFAAVAAATAAVLAAVQAAAFAVGRKIGRYNVVDVAWGLG
FT                   FALAAAVAAAVGQGDLPRRVLFAALIALWGLRLSWHMHRKSAGRGEDPRYEALLERKGG
FT                   ASTWNIIVQVFVIQGLAQWFVSLPVQLSAVLGPTPRAFFPALVAGVGLYTAGVLFEAVG
FT                   DWQLRAFKSNPDNRGRIMDVGLWRWTRHPNYFGDSCVWWGLWLCSLACPASLATVLSPA
FT                   LMTYFLVHATGARLLERHMADRPGYREYQQRTSFFVPWPPRS"
     atgaccgtct tgcacaactt cgccgcggtc gccgcggcca ccgctgccgt cctcgccgca        60
     gtgcaagcag cagccttcgc ggtcggccgc aaaatcgggc gctacaacgt cgtcgacgtc       120
     gcgtgggggc tcggcttcgc cctggcggcc gccgtcgcgg cggccgtcgg gcagggcgac       180
     ttgccccggc gagtcctgtt cgccgctttg atcgccctgt gggggctgcg tttgagctgg       240
     cacatgcacc gcaaatccgc cggtcgaggc gaggaccccc gctacgaggc gcttttagag       300
     cgcaagggcg gggcttcgac atggaacatc atcgtccagg ttttcgtgat ccagggtctc       360
     gcgcaatggt tcgtctcgct cccggtccag ctctccgcag tcctcgggcc cacccctcgg       420
     gcattcttcc ccgccctggt cgccggtgtc ggcctgtaca cggcaggcgt gctgttcgag       480
     gcagtcggcg actggcagtt gcgggcgttc aaaagcaacc cggacaaccg gggccggatc       540
     atggacgtcg gactgtggcg atggacccgc caccccaact atttcggcga ctcttgcgtc       600
     tggtgggggc tgtggctctg ctccctggca tgccccgcaa gcctcgccac cgtgctttcc       660
     ccggcgctca tgacctattt cctcgtccac gccaccggcg cgcggctttt ggagcggcac       720
     atggctgatc gacccgggta ccgcgaatac caacaacgga cctcgttctt cgtgccatgg       780
     ccgccacgat cctga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page