(data stored in ACNUC7421 zone)

EMBL: CP001958.PE200

CP001958.PE200       Location/Qualifiers
FT   CDS_pept        184656..185444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0204"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: mmi:MMAR_5379 acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96693"
FT                   /db_xref="GOA:D6ZAF1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF1"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADG96693.1"
FT                   /translation="MEILYGTVNTAARLMWLYQGLRLKIVGVGNMPARGGAVVALNHTG
FT                   YLDIPFGGLTSFLHKRNMRFMYKTEMRENPFVRWLFDRLRHIPVDRDYGKASYDHAVRL
FT                   LKEGELVAVYPETTISRSFELREFKSGAARMAIDAKVPIVPVIVWGSQRIMTKGHPKAM
FT                   GRTKTPIWIEVGEPIAPDLPPEQLIVKLKESMQAKLYEVQDKYAQTFGPYPPGAWWVPK
FT                   RLGGGAPSLEEADALDAAEAEEKRAKRAAARAAGADEKKH"
     atggaaatcc tgtatggaac ggtcaacacc gccgcccggc tcatgtggct ctatcaggga        60
     ttgcgcctca agatcgtcgg cgtcggcaac atgccggcgc gcggcggcgc ggtggtcgcg       120
     ctcaaccaca ccgggtatct cgacattccg ttcggcgggc tcacctcgtt cctgcacaaa       180
     cgcaatatgc ggttcatgta caagaccgag atgcgggaaa accccttcgt gcggtggctt       240
     ttcgaccggc tccgccacat tcccgtcgac cgggattacg ggaaggcgag ctacgaccac       300
     gcggtccggc tcctcaaaga gggcgagctc gtcgccgtgt acccggagac gacgatttcc       360
     cgcagcttcg agttgcgcga gttcaagagc ggcgcggcgc ggatggccat cgacgcgaag       420
     gtgccgatcg tcccggtcat cgtctggggt tcgcagcgga tcatgaccaa aggccatccg       480
     aaggcgatgg gccgcacgaa gacgccgatt tggatcgagg tgggcgagcc catcgcgccg       540
     gacctgcccc cggagcagct catcgtgaag ctcaaagaga gcatgcaggc caagctctac       600
     gaggtccaag acaaatacgc gcagacgttc ggcccgtacc cgccgggcgc gtggtgggtg       660
     cccaagcgcc ttggcggcgg ggctccgagc ttggaggagg cggacgcgct cgacgcggcg       720
     gaagctgaag agaaacgggc caaacgggcc gcagcccgcg cggcgggcgc agacgagaag       780
     aagcattag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page