(data stored in ACNUC7421 zone)

EMBL: CP001958.PE205

CP001958.PE205       Location/Qualifiers
FT   CDS_pept        complement(188616..189251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0209"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mab:MAB_3534
FT                   acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96698"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF6"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADG96698.1"
FT                   /translation="MTAKNRLVLIRHGETEWSRIGRHTSVTDLPLLPLGQTQAQGLKGP
FT                   LEQLQLRDPLVYSSPRKRALHTAELAGLTVNETWNDLAEWNYGEYEGLTTHQIRMMEPD
FT                   WSVWTHPSPDGESEEDVLHRADQVIREAVSRLAYHDVVLVGHGHFSRALLVRWLEQPLM
FT                   LGRRFAFPAASITVLGHEHDLRVVECLGVRSAQTGYMDGVSLPVAPMA"
     atgactgcaa agaaccggct cgtgctcatc cggcacggcg aaaccgaatg gtcccggatc        60
     ggcaggcaca ccagtgtcac cgaccttccc cttctgccac tcggacaaac gcaggcgcag       120
     ggattgaaag ggccgctcga acagctgcaa ctgcgcgatc cgctggtgta ttcaagtccg       180
     cgcaagcgcg cgttgcacac cgccgagctg gccgggctca ccgtcaacga gacctggaac       240
     gatctcgccg aatggaacta cggcgagtac gagggtttga cgacccacca gatccgcatg       300
     atggagccgg attggtcggt gtggacgcac ccttcgccgg acggggaaag cgaagaggac       360
     gtgctgcatc gcgcggacca ggtgatccgt gaggccgtgt cgaggctggc ctatcacgat       420
     gtggtgctgg tcggccacgg gcatttcagc agggcgctgc tggtgcgctg gctcgaacag       480
     cccctgatgc tggggcgacg gttcgctttt cccgccgcgt ccatcactgt gctcggccac       540
     gagcacgatc tccgggtcgt cgaatgcctc ggggtccgga gcgcgcaaac cggctacatg       600
     gacggggtca gcctcccggt cgcgccgatg gcttga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page