(data stored in ACNUC7421 zone)

EMBL: CP001958.PE212

CP001958.PE212       Location/Qualifiers
FT   CDS_pept        complement(195090..195731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0216"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mab:MAB_3527
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96705"
FT                   /db_xref="GOA:D6ZAG3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG96705.1"
FT                   /translation="MSPQPAAPRRTPGSRPASRGRLAKTDRRKLLLSAANDVFADSGFH
FT                   KSSMEDIADRAGVSKPVLYQHFPSKLELYLTVLDGHVEELVLRVRQALRSTTDNNGRLI
FT                   AAVRAFFDVIDNDTQGYKLIFNTDVMLPEVQSRISRATDACVDAVFDLVRQDSGLGLHQ
FT                   ARMIAVGLVGLIQVSARHWQDTGQPIAKEEAVFAAVSLAWGGLSRVPKLD"
     atgagccccc aacccgcagc gccgcgacgg acgcccggat cgcgccccgc aagccgcggc        60
     aggctcgcca agacagaccg gcgaaagctg cttctgagcg cggcgaacga cgtcttcgcg       120
     gattcgggct tccacaagtc ctcgatggaa gacatcgccg atcgcgccgg cgtgagcaaa       180
     cccgtcctct accagcactt cccttccaaa ctcgagctgt atctgaccgt gctggacggg       240
     catgtggagg agcttgtgct ccgagtgcgc caagcattgc gctccaccac cgacaacaac       300
     ggcaggctca tcgcggcagt gcgggcgttc ttcgacgtga tcgacaacga cacccagggc       360
     tacaagctga ttttcaacac ggacgtgatg ctccccgaag tccagtctcg catcagcagg       420
     gcgaccgacg cgtgcgtgga cgcggtgttc gacctggtcc gccaagattc cggcctcggc       480
     ctgcaccagg ccaggatgat cgccgtcggg ctcgtcgggc tcatccaggt cagcgcgagg       540
     cactggcagg acaccggcca gccaatcgcg aaggaagaag ctgtgttcgc cgccgtctcc       600
     ctcgcgtggg ggggcctttc ccgcgtgccg aagctcgact ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page