(data stored in ACNUC7421 zone)

EMBL: CP001958.PE213

CP001958.PE213       Location/Qualifiers
FT   CDS_pept        complement(195788..197275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0217"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: mva:Mvan_0932 permease for
FT                   cytosine/purines, uracil, thiamine, allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96706"
FT                   /db_xref="GOA:D6ZAG4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG4"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /protein_id="ADG96706.1"
FT                   /translation="MSVRYFLRMPAALDEDVVAGHDPRLTNADLAPTRRQNWGVYNFVA
FT                   FWMTDVHSVAGYTAAGSLFALGLAGWQVFVAIMVAVVALYGLSNLVAEPSQRTGAPYPV
FT                   VCRLSFGVLGAKIPAVLRALNAVAWYGMQTYLAANAVTLALVKLFPSARAYADAGEHGF
FT                   LGLSAVGWATFLMVWGAQTLIFWHGMDFIRRFIDWAGPAVYAVMIALCGWLIQQTGWGA
FT                   IRFDLSGGEGQQSWAASLCAMVGAVGLVVSYFGAPVLNFGDFAKYGKSMRVVRTSGFFG
FT                   LPVNFLFFSLLVVVTASLTVPVFGEMVADPNGVVTRIPNSTAVVIGVLTILIATVGINI
FT                   VANFVSAAFDLSNVKPQRISWLGGGMAAAAASVFIAPWKLIENPAAFHVTAETLGAFLG
FT                   ALYAVLVVDYYLVRRRRIVADDLYSMSETGSYWYTRGFHLPAIAATAVGAASAAACVVA
FT                   DDPGASLAVRTLAQCSWFVGASIGGLAYWLLARKHRK"
     atgtctgtcc ggtattttct gcggatgcct gccgctttgg acgaagacgt ggtcgccgga        60
     cacgatccga ggctgaccaa tgcggacttg gccccgactc gtcgccaaaa ctggggcgtg       120
     tacaactttg tcgcgttctg gatgactgat gtgcacagtg tggccgggta cacggcggcg       180
     gggagcctgt tcgccctcgg cctcgcgggc tggcaggtgt tcgtggcgat catggtggcg       240
     gtcgtcgcct tgtacgggct ctccaacctc gtcgccgagc cgagccaacg caccggcgcg       300
     ccgtatcccg tggtgtgcag gctgtcgttc ggcgttctcg gcgcgaagat ccctgctgtc       360
     ctgcgcgcgc tcaacgctgt ggcttggtac gggatgcaga cctacctcgc cgcgaacgcg       420
     gtcactttgg ccctggtcaa gctgttccct tcggcgaggg cgtacgccga cgccggggag       480
     cacggcttcc tcgggctctc cgctgtcggc tgggcgacgt ttctgatggt gtggggcgct       540
     cagacgttga tcttctggca tgggatggac ttcatccgca ggttcatcga ttgggccggc       600
     cccgccgtct acgcggtcat gatcgcgctc tgcggatggc tcatccagca gaccgggtgg       660
     ggtgcgatcc ggttcgatct cagcggcggc gaggggcagc aaagctgggc ggcctcgttg       720
     tgcgccatgg tcggcgcggt cgggctggtg gtgtcctatt tcggggctcc ggtgctgaac       780
     ttcggggatt tcgccaagta tgggaaatcc atgcgggtgg tgcgcacgtc cggatttttc       840
     ggcctgccgg tgaacttcct gtttttctcg ctgttggtcg tggtcaccgc ctcgctcacg       900
     gtccccgtgt tcggggagat ggtggccgac ccgaacgggg tcgtcacgcg gattccgaac       960
     tcgacggccg tggtgatcgg agtcctgacg attctcatcg cgaccgtggg catcaatatc      1020
     gtcgcgaact tcgtctccgc tgcgtttgat ttgtcgaatg tgaagccgca gcggatcagc      1080
     tggttgggcg gcgggatggc cgccgccgcg gcttcggtgt tcatcgcgcc gtggaagctg      1140
     atcgagaacc ccgccgcctt ccacgtcaca gcggaaaccc tcggcgcgtt cctcggcgcg      1200
     ctgtacgcgg tgctggtcgt cgactattac ttggtgcgcc gaaggcgcat cgtggcggac      1260
     gatctgtaca gcatgtcgga aacgggcagc tactggtaca cgcgggggtt ccatctgccc      1320
     gcgatagcgg ccactgcggt cggcgcggcc agcgcggcgg cgtgcgtggt cgcggacgac      1380
     cccggggcct cgctcgcggt gcgcacactc gcgcagtgca gctggttcgt cggggcttcg      1440
     atcggcggtc tggcgtattg gctgcttgcg cgaaaacacc ggaagtga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page