(data stored in ACNUC7421 zone)

EMBL: CP001958.PE215

CP001958.PE215       Location/Qualifiers
FT   CDS_pept        197853..198797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0219"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmi:MMAR_0983
FT                   lipase/esterase LipG2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96708"
FT                   /db_xref="GOA:D6ZAG6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG96708.1"
FT                   /translation="MNEAQQAIPRRTGFAHNERPGHAPVQLFYEEFGAATDPTVLLVMG
FT                   LGAQMLLWPTDLCEELARLGFHVVRFDNRDIGLSSRLDGLQSKATLPFRLVRLFLGLPS
FT                   AMPYSLHDMASDAIAVLDHVGAPRAHVVGASMGGMISQLLAADHPDRVLSLGLFFTCAI
FT                   ERFAIAPRAKILAFFAETAPKNPTREQEIDAFVRSYEHLAGRHYPLETELLRRECEAMW
FT                   DRNPDAEGPMRQLDAIIGTGSIAASAARIDRPTVIIHGSDDPVIRVSCGESLARLIPGA
FT                   KLNVVDGMGHTLPLVLLDFFVEELTANFARAQA"
     atgaacgaag cgcagcaggc gatcccgcgc cgcaccggtt tcgcgcacaa cgaacgtccc        60
     ggccacgccc cagtccagtt gttctatgaa gaatttggcg cggcgaccga cccgaccgtg       120
     ctgctcgtca tggggctcgg cgcgcagatg ctcctgtggc cgacagacct gtgcgaggag       180
     ctcgcccgcc tcggcttcca tgtcgtccgc ttcgacaacc gcgacatcgg gctctcatcg       240
     cggctcgacg gcctccaatc caaggcgact ttgccgtttc ggctggtccg gctcttcctc       300
     ggcctgccca gcgcgatgcc gtacagcctg cacgacatgg catcggacgc catcgcagtg       360
     ctcgaccatg tgggcgcccc gcgcgctcat gtcgtcggcg cctcgatggg cgggatgatc       420
     tcccagctcc tcgccgccga ccacccggat cgtgtgctca gcctcggcct ctttttcacc       480
     tgcgccatcg agcgcttcgc catcgcgccc cgagcgaaaa tcctcgcttt cttcgccgag       540
     accgcgccga aaaacccgac gagagaacaa gagatcgacg cgttcgtccg cagctacgag       600
     cacctcgccg gacgtcacta ccccctcgag acggagttgt tgcggcggga atgcgaggcc       660
     atgtgggacc gcaatcccga cgccgaaggc cccatgcgcc aattggacgc gatcatcggc       720
     acgggcagca tcgccgcatc cgccgcccgc atcgaccgcc cgaccgtcat catccacggc       780
     tctgacgacc ccgtgatccg ggtgtcctgc ggcgaatccc tcgcccggct catccccgga       840
     gccaaactga acgtcgtcga cggcatgggg cacacattgc cgctcgtcct gctcgacttc       900
     ttcgtcgagg agctgaccgc caacttcgcg cgcgcgcagg cataa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page