(data stored in ACNUC7421 zone)

EMBL: CP001958.PE218

CP001958.PE218       Location/Qualifiers
FT   CDS_pept        complement(202324..202620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx05400 preprotein translocase subunit
FT                   SecA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96711"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96711.1"
FT                   /translation="MADMANPDGVRSSGQDFHGFAEKAKTIAEQLKGLQMAKGMGAAFS
FT                   AEAEAMQRGLDKVPVPFQHHGEYNNVFGTVLAEAAASYQGTDESNERDLKIDL"
     atggcggata tggccaaccc ggacggagtg cgcagctcag gccaggactt ccacggtttc        60
     gcggagaagg cgaaaaccat agcggaacag ctcaagggcc tccagatggc gaaggggatg       120
     ggcgcggcgt tctccgcaga agcagaagcg atgcagcgcg gcttggacaa ggtgcctgtg       180
     cccttccagc accatggcga gtacaacaat gtcttcggca cagtgctggc cgaagccgcc       240
     gcctcctatc aaggaacaga cgagagcaac gaacgcgatc tgaagatcga cctgtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page