(data stored in ACNUC7421 zone)

EMBL: CP001958.PE219

CP001958.PE219       Location/Qualifiers
FT   CDS_pept        202783..203211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96712"
FT                   /db_xref="InterPro:IPR009550"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96712.1"
FT                   /translation="MQPADVLYNMAQSALKRNEQTFQAFQKSMAQRKAQQEALYAQVKE
FT                   KNTAEPTAEELKAEKGERKAASIWNDTGKFGNLESEESVSEEPVKRDVRADADTRSFRP
FT                   VDEDEEAEDAPVGRHSRPDDGIWGASTRKIGSYQDEEE"
     atgcaaccgg ctgatgtgct ctacaacatg gcgcaatctg cgctcaagag gaacgagcaa        60
     actttccagg cgtttcagaa atctatggca cagcgcaaag cgcaacaaga ggccctctac       120
     gcccaggtga aagagaagaa caccgcggag cccacggcgg aggagctgaa ggccgagaag       180
     ggcgagcgca aggcagcgtc catctggaac gacactggca aattcggcaa tctcgaatcg       240
     gaagagtccg tctcagagga gcccgtcaag cgcgatgtgc gcgccgacgc ggacactcgt       300
     tcctttcgcc ctgtcgacga ggatgaagag gccgaggacg cgcctgttgg ccgccatagc       360
     aggccagatg acggcatctg gggcgcgagc acgagaaaga tcggaagtta ccaagacgag       420
     gaggaatga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page