(data stored in ACNUC7421 zone)

EMBL: CP001958.PE22

CP001958.PE22        Location/Qualifiers
FT   CDS_pept        24170..24880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0022"
FT                   /product="Anti-sigma K factor RskA"
FT                   /note="PFAM: Anti-sigma K factor RskA; KEGG: mva:Mvan_4928
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96515"
FT                   /db_xref="GOA:D6Z9I8"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I8"
FT                   /inference="protein motif:PFAM:PF10099"
FT                   /protein_id="ADG96515.1"
FT                   /translation="MSRPGEPPAGLLGLAAPYALHAVSDTERAAIERALREADPAEAQA
FT                   FRNEVRRIHETMADVAALTAVEPPERLKARIVAATAQTRPKWFQRTSLRVAAVAATLLV
FT                   GLAAGAGWMLLGRSPAPPSAAARILAAPDVRAVSGAIPGGGTATVVFSPELHKAVLVMN
FT                   DVAPPRPGTVYELWLVGPNGPEPAGTMDAHAISPSTTAVIDNLGDSTVVGLSVEPPGGS
FT                   RKPTGAMFAELRLA"
     atgagcagac caggcgaacc ccccgcaggc ctgctcggcc tcgccgcgcc gtacgcgctg        60
     cacgccgtca gcgacacaga acgcgccgcc atcgagcggg cgctgcgcga agccgacccg       120
     gccgaggccc aggcgttccg aaacgaagtg cgccgcatcc acgagaccat ggccgacgtc       180
     gccgcgctca cggcagtcga accgccggag cgcctgaaag cgcgcatcgt cgccgccact       240
     gcccaaaccc ggccgaaatg gttccagcga acctccttgc gcgtggcggc ggtcgccgcc       300
     acgctcctcg tcgggctggc tgccggcgcg ggatggatgc tcttgggccg cagcccagcg       360
     cccccgtctg ctgccgcccg catcctcgca gcccccgacg tccgggcagt gagcggcgcg       420
     attcccggcg gcggcacggc caccgtggtg ttctcccccg aattgcacaa agcggttctg       480
     gtgatgaacg acgtcgcgcc cccacggcca gggaccgtct acgaactctg gctcgtcggc       540
     ccgaacgggc cagaaccagc tggcaccatg gacgcgcacg ccatatcgcc gtccaccacc       600
     gccgtgatcg acaacctggg cgactccacc gtggtcggcc tctccgtgga accgcccggc       660
     ggctcccgca agcccaccgg agcgatgttc gccgaactgc ggctcgcctg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page