(data stored in ACNUC7421 zone)

EMBL: CP001958.PE220

CP001958.PE220       Location/Qualifiers
FT   CDS_pept        complement(203460..203687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0226"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   eba:ebA2762 anaerobic benzoate catabolism transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96713"
FT                   /db_xref="GOA:D6ZAH1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH1"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADG96713.1"
FT                   /translation="MGELNETVSRTVQGHLDRLGLSRSDAAQALGVSQQTLADLLGNHR
FT                   VWRLDEVDSIAEWLEVSPKDLFFPGRGDSV"
     atgggagagc tcaacgagac tgtgagccgg acagtccagg ggcacctgga ccggcttggc        60
     ctgagccggt ccgacgcggc gcaggcactc ggggtcagcc agcaaacctt ggccgatctg       120
     ctcggcaatc accgcgtgtg gcggctggac gaggtcgaca gcatcgccga atggctcgaa       180
     gtgagcccga aagacctgtt ctttccgggg cgcggagatt ctgtttaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page