(data stored in ACNUC7421 zone)

EMBL: CP001958.PE224

CP001958.PE224       Location/Qualifiers
FT   CDS_pept        complement(206934..207416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96717"
FT                   /db_xref="GOA:D6ZAH5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH5"
FT                   /inference="similar to AA sequence:KEGG:MAB_0655"
FT                   /protein_id="ADG96717.1"
FT                   /translation="MGADDVEKLRLVLAPVPYDTVWLVLAALLVAAAAGCLVGIFVWTL
FT                   PVERLRRVPVLREITLRRLKRAFSRSIDATAARHRRGEISSRAAHGSISRGMRVFLQLW
FT                   TGEPAGKMVLAEFAESPLAGASGALETLYPGQFAPQEQPDVERAAAAAKEVIAGWR"
     gtgggagctg acgacgtcga gaagctgcgg ctggtgctgg cgcccgtgcc gtacgacacg        60
     gtgtggcttg tgctcgctgc cctgctggtg gccgcagccg ctggctgcct cgtcgggatt       120
     ttcgtgtgga cgctgcccgt ggagcggctg cggcgcgtgc cggtgctgcg cgagatcacg       180
     ttgcggcggc tcaagcgcgc attctcccgc tccatcgacg ccacggcggc ccggcacagg       240
     cgcggcgaga tctctagccg cgcggcgcac ggctcgatca gccggggcat gcgcgtgttc       300
     ctgcaactgt ggaccgggga gcccgccggc aagatggtgc tcgccgaatt cgccgaaagc       360
     cccctcgcgg gggcctccgg ggccttggaa accctctacc ccggccagtt cgcccctcag       420
     gaacaaccgg acgtggagcg cgccgccgcg gcggccaagg aggtgatcgc cggatggcgc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page