(data stored in ACNUC7421 zone)

EMBL: CP001958.PE225

CP001958.PE225       Location/Qualifiers
FT   CDS_pept        complement(207406..208323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0231"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   mab:MAB_0654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96718"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH6"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADG96718.1"
FT                   /translation="MGALLQRVRAQVLAGQKLVGPAGKARGLLEGGHLSLFHGRSQEFD
FT                   DLRPYVPGDDVRDIDWKATARSDSLLVKRFVSLRQHNILLVVDVSRSMAAVAPSGEVKR
FT                   DVAVNAMGLVGLICIAKGDEVGLVYGDARGSARMPPGRGETHVEHILAKVSGHDLDHAA
FT                   RESLCAQLAYVERNFRKRYVVFLVSGEPHLDDDGSAPGALAGQLRRVAARHDLYWIIVR
FT                   DAPILEPESGSGGGYDVETGRALLREEALGRKVLAAYRHAEERRESAFADFLAASGVRA
FT                   ARVEGTAALRREVTALLSRSGRGS"
     atgggggcat tgctgcagcg ggtccgcgcg caggtgctgg ccgggcagaa gctggtcggc        60
     cccgccggga aagcgcgggg gctcctcgaa ggcggtcacc tgtccctctt ccacggccgc       120
     agccaggaat tcgacgacct gcggccatat gtgccgggcg acgacgtgcg cgatatcgac       180
     tggaaggcaa ccgcgcgcag cgacagcctg ttggtgaaac ggttcgtctc tctgcgccaa       240
     cacaacatcc tcctcgtcgt ggacgtgagc cgttcgatgg cggccgtcgc gccgtccggc       300
     gaggtcaaac gcgacgtcgc ggtcaacgcc atgggactgg tgggactgat ctgcatcgcg       360
     aaaggggacg aggtgggcct cgtctacggg gacgcgcgcg ggtcggcccg gatgccgccg       420
     ggccggggcg aaacgcacgt cgagcacatc ctcgccaaag tgtcggggca cgacctagac       480
     cacgccgcgc gggagagcct ctgcgcgcaa ctcgcgtatg tggagcgcaa cttccgcaaa       540
     cggtatgtcg tcttcctcgt ctccggcgaa ccgcacctgg acgacgacgg ctcggcgccg       600
     ggcgcccttg ccggacagtt gcgcagggtc gcggcccggc acgatctgta ctggatcatc       660
     gtgcgggacg cgccgatcct cgaaccagaa tccggatcgg gcggcggcta cgacgtggaa       720
     accgggcggg cgctgctgcg cgaggaggcg ctggggcgca aagtgctcgc cgcctaccgt       780
     cacgcggagg agcggcgcga gagcgccttc gccgacttcc tcgccgccag cggtgtgcgc       840
     gccgcgcggg tggagggcac cgccgcgctg cgccgcgaag tcaccgccct gctgagccgg       900
     agcggccgtg ggagctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page