(data stored in ACNUC7421 zone)

EMBL: CP001958.PE229

CP001958.PE229       Location/Qualifiers
FT   CDS_pept        complement(212177..212527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0235"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: fal:FRAAL1243 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96722"
FT                   /db_xref="GOA:D6ZAI0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI0"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG96722.1"
FT                   /translation="MKVNRVVPNLECASLQQAKDFYTRVLGLRVVMDHGWIVTLADPQR
FT                   PETQVSLTTHDETAPLVPAVSIHVDDVDAAYREAVATGAEIVHDLVDEPWGVRRFFVRD
FT                   PEGHVINILAHG"
     atgaaggtga acagagtcgt tccaaacctc gaatgcgcgt ccctgcaaca ggccaaggat        60
     ttttacaccc gggtcctggg gttgcgcgtc gtcatggatc acggctggat cgtgacgctg       120
     gccgacccgc aacggcccga aacccaggtg agcctcacaa cccatgacga aaccgcgccc       180
     ctcgtcccgg ccgtctccat ccatgtcgac gatgtcgacg ccgcctatcg ggaggctgtg       240
     gccaccgggg ccgaaatcgt gcacgacctc gtcgacgagc cctggggcgt gcgccgattc       300
     ttcgtccggg accccgaagg gcatgtgatc aacattctgg cgcacggctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page