(data stored in ACNUC7421 zone)

EMBL: CP001958.PE23

CP001958.PE23        Location/Qualifiers
FT   CDS_pept        complement(24905..25657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_49090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96516"
FT                   /db_xref="GOA:D6Z9I9"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I9"
FT                   /inference="similar to AA sequence:KEGG:ROP_49090"
FT                   /protein_id="ADG96516.1"
FT                   /translation="MDTEPKDTAAEIVVSLSGIRDTTLGQARAFAELLDARGVPLSLLV
FT                   APKLPGKYKLAKDPGTADWLRERRAHGDAIVLHGYDQAATKRRKAEFAALPEYEARLRL
FT                   TAADRMMDHLGLRTRLFAPPEWAASPGAQAVLPALGFHQLVRADSVLEVRAGAARPARL
FT                   FAPRPKYESWQRRVVSFWAWRSGRRGELAQLAISGKHLETESVRGLFFEALGLALERGV
FT                   RPVRYTDLLGVSTTGGGPRFAALVTDVA"
     atggacacgg agccaaagga cactgccgcg gagattgtgg tgtcgctgtc gggcatccgg        60
     gacacgacgc tcggccaggc gcgtgctttc gccgaactgc tcgatgcgcg gggcgttccg       120
     ttgtcgctgc tggtggcgcc gaaactacct gggaagtaca agctggccaa agatccgggc       180
     acggcggatt ggctgcggga gcgccgggcg cacggcgacg cgatcgtgtt gcacggctac       240
     gaccaggcgg cgacgaaacg gcggaaagcg gagttcgcgg cgttgcccga gtatgaggcg       300
     cggctgcggc tgacggccgc ggaccggatg atggatcatc ttggtctgcg cacgaggctg       360
     ttcgccccgc ctgagtgggc ggcttcccct ggcgcgcagg ctgtgctgcc cgcattgggc       420
     tttcatcagc ttgtccgcgc cgattcggtg ctcgaagtcc gagcgggggc ggcacggcct       480
     gcgcggcttt tcgcgccccg gcccaaatat gagtcgtggc agcggcgcgt ggtgagtttc       540
     tgggcgtggc gcagcgggcg ccggggcgag ctggcgcagc ttgcgatttc ggggaaacac       600
     ttggaaacgg aaagcgtgcg cgggctgttc ttcgaagctc tcgggctggc gttggaacgc       660
     ggcgtgcggc cggtgcgcta cacggacctt ctgggagtct cgaccacggg gggcggtccg       720
     cggttcgccg cgctggtgac ggacgtcgca taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page