(data stored in ACNUC7421 zone)

EMBL: CP001958.PE230

CP001958.PE230       Location/Qualifiers
FT   CDS_pept        complement(212599..213102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0236"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: ami:Amir_0411 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96723"
FT                   /db_xref="GOA:D6ZAI1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG96723.1"
FT                   /translation="MGTGQPSGLAPEAKAPFHVGCYGDAADVFYLLLRILRGMRRAGDM
FT                   SSLTVSGISALFVIAQHGPLRLGDLANRERVTAPTMSRVVTLLEQAELVQREPDPADGR
FT                   ATLLSLTPQGSEYVAGDASEKIKTVESALATLSDEEQKQVVRWLQTLEAAVAKSSPEVD
FT                   DDLC"
     gtgggaaccg gacagccgtc agggcttgcg cccgaggcga aggccccgtt ccatgtggga        60
     tgctacggag atgccgccga cgtgttctac ttgcttctgc ggattctgcg cggcatgcgc       120
     agggctggcg atatgagttc gctcacagtg agcggtatat ccgcgctctt cgtgatcgcc       180
     cagcacgggc cgttgcgcct cggcgacctc gcgaaccgcg aacgggtcac cgccccgacg       240
     atgtccaggg tcgtcacgct tttggaacaa gccgagttgg tgcagcgcga gcccgacccc       300
     gccgacgggc gcgccacctt gctctctttg accccgcagg gcagcgagta tgtcgcggga       360
     gacgcgtccg agaaaatcaa gaccgtcgaa agcgccttgg cgacgttgag cgacgaggag       420
     cagaaacagg tcgtgcgctg gctccagacg ctcgaagccg cagtggccaa gtcttcgccc       480
     gaggtcgatg acgacctctg ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page