(data stored in ACNUC7421 zone)

EMBL: CP001958.PE232

CP001958.PE232       Location/Qualifiers
FT   CDS_pept        complement(214004..214216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_07g019490; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96725"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96725.1"
FT                   /translation="MKRGRHKPEPAPPAGLGRPAVIALIAVHYGADESAASRRGDLGET
FT                   SGGEKLGDCGAWAAPSSDVTERARC"
     gtgaagcggg ggcgccataa accagagcca gcgcccccag ccggtttggg ccgcccggcc        60
     gtcatcgcgc tgatcgccgt ccactacggc gcggacgaga gcgccgcgag ccgcaggggc       120
     gatctgggcg aaaccagcgg cggcgaaaag cttggggact gcggcgcctg ggccgcgccc       180
     tcgtccgacg tcacagagcg cgcgcgctgt tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page