(data stored in ACNUC7421 zone)

EMBL: CP001958.PE234

CP001958.PE234       Location/Qualifiers
FT   CDS_pept        215206..216189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0240"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: nfa:pnf1570 putative cation transporter;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96727"
FT                   /db_xref="GOA:D6ZAI5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI5"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADG96727.1"
FT                   /translation="MAHDHDHAHGVGESSDRTWLFAALCLLLLLMAAEAAAGLLSGSLA
FT                   LLSDAAHMLTDVASLGLAIMAVKLAARPARGAMTYGLRRVEILSAQINGATLLILGGWF
FT                   AYEGVQRLLRPHQVEGKLVLVTALVGVVVNLAATMCVNKANRASLNIEGAFQHILADLY
FT                   AFIATVVAGLVIWLTGFSRADALAALVVAGLMLTSGWTLVRAASRVLLEAAPNGFSPDA
FT                   IGAELAALPGVVEAHDLHIWEISSGHPALSVHVLVDEDADCHERRVAIKQLLWEEHGVE
FT                   HTTIQVDHFAAGEEHCHEPHGLVHRSGRDEIRVIEHTGTHGHHCRG"
     atggcgcacg accacgacca cgcgcacggc gtgggcgaga gcagcgaccg cacctggctt        60
     ttcgccgcgt tgtgcctgct cctgctgctc atggcggcag aagcggcggc ggggttgctc       120
     tcgggctcgc tggccctttt gtcggacgcc gcccacatgc tcaccgacgt ggcctcgctc       180
     ggccttgcga tcatggccgt caaactcgcc gcccgccccg cccgaggggc catgacctac       240
     gggctgcgcc gggtggagat cctttccgcg cagatcaacg gggcgacgct cctgatcctc       300
     ggcggctggt tcgcttacga aggcgttcag cggctcctgc gcccccacca ggtcgaaggc       360
     aaactcgtgc tggtcacagc cctcgtgggc gtggtggtga atctcgccgc gacgatgtgc       420
     gtcaacaagg cgaaccgcgc cagcctgaac atcgaaggag ccttccagca catcctcgcc       480
     gacctttacg cctttatcgc cacagtcgtc gctggcctgg tgatctggtt gaccggattc       540
     tcccgcgcgg acgcgctcgc cgcgctcgtc gtcgccgggc tcatgctcac atcgggctgg       600
     acgctggtgc gcgcggcctc ccgggtcctg ctcgaagccg cgccgaacgg cttctcgccg       660
     gacgccatcg gcgctgaact cgccgcgctc cctggtgtcg tcgaggcgca cgacctgcat       720
     atttgggaga tctcctccgg gcatcccgct ctttcggtcc atgtgctggt cgacgaggac       780
     gcggactgcc atgagcggcg cgtggcgatc aaacagctcc tgtgggagga gcacggcgtc       840
     gagcacacga cgatccaagt ggaccacttc gccgccgggg aagagcactg ccacgagccg       900
     cacgggctgg tgcaccggtc tggacgagac gaaatccgcg tcatagagca cactggtacg       960
     catgggcatc actgtcgagg ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page