(data stored in ACNUC7421 zone)

EMBL: CP001958.PE235

CP001958.PE235       Location/Qualifiers
FT   CDS_pept        216167..217330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0241"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rme:Rmet_5086 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96728"
FT                   /db_xref="GOA:D6ZAI6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI6"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADG96728.1"
FT                   /translation="MGITVEADFLVVGAGIAGASTGYFLAQHGKVVVLEREAAPGQHAT
FT                   GRSAAMYEPAYGNAQVRALTAASRSFFDSPPEGFAEHPLLSPRGVVIAQLAGEEFGPGA
FT                   DPAGPALTDEALIADLLEVPGATLLSKHDVLSLIPVLREEMVLGGVHDAQAEDVDVGEL
FT                   HLGFLKGIRARGGEVRCGRGVAAVSRVGAAWQVQAGDESYRAPVLVNAAGAWADVVARL
FT                   AGVREIGLVPKRRSAFVFHPPHGLDVRALPMFKDLRIGFYVKPDAGMLLGSPANADPTH
FT                   PQDVRPPDLDVALAIHRIEEATTLTVGRPLRAWAGLRSFVRDGGLVGGYAPDAAGFFWV
FT                   AAQGGYGIQTSPAMGEATAALALGEQIPEHIAAHSLTAEALAPDRLR"
     atgggcatca ctgtcgaggc tgacttcctt gtcgtcggcg cggggatcgc cggggcttcg        60
     accgggtact tcctcgccca gcacggcaaa gtcgtcgtgc tggaacggga agccgcgccg       120
     gggcagcacg ccactggccg ctctgccgcg atgtacgaac ccgcctacgg caacgcccaa       180
     gtgcgcgccc tcacggcggc gagccgcagt ttcttcgact cgccgcccga aggcttcgcc       240
     gaacacccgc tgctctcccc ccggggggtg gtgatcgcgc agctcgccgg ggaagaattc       300
     gggcccggag ccgacccggc aggaccggcg ctgaccgacg aagccctgat cgcggacttg       360
     ctcgaagtgc ccggtgcgac attgctcagc aagcacgacg tgctctcgct catcccggtg       420
     ctgcgagaag aaatggtgct cggcggggtg catgacgccc aggccgagga cgtggacgtc       480
     ggcgagctgc acctcggctt cctgaaggga atccgggcgc gcggcggcga agtccgctgc       540
     gggcgcgggg tcgccgcggt cagccgcgtc ggggccgcct ggcaggtcca ggcgggggac       600
     gagtcctatc gcgcccccgt gctcgtcaac gccgccgggg cttgggccga cgtggtcgcg       660
     cggctcgccg gggtccgcga gatcggtttg gtccccaaac gccgctccgc gttcgtcttc       720
     cacccgccgc acgggctcga cgtccgcgcg ttgccgatgt tcaaggattt gcgcatcggt       780
     ttctacgtga agccggacgc gggcatgctc ctcggctccc cggcgaacgc cgacccgacg       840
     cacccgcagg acgtgagacc gccggacctg gacgtcgccc tcgcgatcca ccgcatcgaa       900
     gaggccacca cgctcacagt gggccgcccg ttgcgcgcat gggcggggct gcgctccttc       960
     gtccgcgacg gggggctggt cggcgggtac gcgccggacg cggcggggtt cttctgggtc      1020
     gccgcgcagg gcggctacgg catccaaacc tctcccgcca tgggcgaggc gaccgccgct      1080
     ctggccctgg gcgagcagat ccccgaacat atcgccgcgc acagcctcac cgcggaggcg      1140
     ctggccccgg accggctgcg atga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page