(data stored in ACNUC7421 zone)

EMBL: CP001958.PE238

CP001958.PE238       Location/Qualifiers
FT   CDS_pept        218317..221145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0244"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: nfa:nfa55240 leucyl-tRNA synthetase; TIGRFAM:
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96731"
FT                   /db_xref="GOA:D6ZAI9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI9"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADG96731.1"
FT                   /translation="MTEPAAHRYDNATVRRIEEFWQAEWQRSGALHADNPTGELAGDGA
FT                   AREPFFIMDMFPYPSGDGLHVGHPLGFIATDVFARFQRMAGKNVLHTMGFDSFGLPTEI
FT                   YAVQTGTHPAAVTDRNVERFLRQIRRIGLGHDERRRFKTSDPDYYRWTQWIFLKIYNAW
FT                   YDREAGRARPVGELEAAFASGARATPDGRAWSALTKAEQRAVVDSHRLVGRHESVVNWC
FT                   PGLGTVLSNEEVTDEGRSERGNFPVFRKSLRQWTMRITEYADRLIDDLDRLDWPEKVKS
FT                   MQRNWIGRSTGAVVSFPCGEQVLEVFTTRPDTLYGVTFLVAAPESELVASLVPQAWPVG
FT                   TDPRWTGSAATPAEAVATYRAKVANRAERERQEDKAKTGVFTGAFAVNPLTQERIPVFV
FT                   ADYVLAGYGTGVVMAVPGHDQRDWDFAKTFGLPVAEVVSGGDVEIGAHTGEGQLVNSGS
FT                   WDGLSASEAKAVAADDLERLGVGRKQLQYKLRDWLFARQRYWGEPFPLVADESGQVFPL
FT                   DDTALPVLLPQIEDFRPIVFDADDQDSRPSAPLKKAGDWLTVECDFGDGAQPYTRETDV
FT                   MPNWAGSCWYYLRYLDPKNEEAFCDPENERYWIGPRPDARGGADPGGVDLYVGGTEHAV
FT                   LHLLYARFWHKVLHDLGYVSSAEPFRRLFNQGYIQAPSYTDSRGAYVPAAEVEERDGEF
FT                   FWQGQPVKREFGKMGKSLKNSITPDEICDEYGADTLRVYEMSMGPLDQSKDWSTKDIVG
FT                   AQRFLARVWRVVVDEQSGQACVVDAEPDAETVRALHRAIDQVGQEYAALKFNLAVAKLI
FT                   EYTNYLTKRYLSGQQGAEGAPRAAVEPLVVMLAPLAPHLAEELWRRLGHDELLVRHPFP
FT                   TADPAFLVDDEVKLPVQVAGKVRATIVVPAGVSEDVVRAAALADPKVVEHLAGKEPKRV
FT                   IVVPKKMVSIVL"
     atgactgaac ctgccgcgca tcgttacgac aacgccaccg tccggcgcat cgaggagttt        60
     tggcaggccg agtggcagcg ttcgggggcg ctgcacgcgg acaacccgac cggcgagctc       120
     gcgggcgacg gcgcggcgcg ggagccgttc ttcatcatgg acatgttccc ctacccctcc       180
     ggggacggat tgcacgtcgg gcatccgctc ggcttcatcg ccaccgacgt gttcgcccgg       240
     ttccagcgga tggcgggcaa gaacgtcctg cacacaatgg gctttgactc cttcggcctg       300
     cccacggaga tttacgcggt gcagaccggg acacacccgg cggcggtgac cgaccgcaac       360
     gtcgagcggt tcttgcgcca aatccgccgc atcggcctcg gccacgacga acgccgccgg       420
     ttcaaaacct ccgacccgga ctactaccgt tggacgcagt ggatcttcct gaagatttac       480
     aacgcctggt acgaccgcga ggctggccga gcccggccgg tgggcgagct ggaggcggcg       540
     ttcgcctccg gagcgagggc gacgccggac gggcgcgcgt ggtccgcgct gaccaaggcc       600
     gagcaacgcg cggtcgtcga ctcgcaccgg ctcgtgggca ggcacgagtc ggtggtgaac       660
     tggtgccccg gcctcgggac ggtgctgtcg aacgaggagg tcaccgacga gggccgctcg       720
     gagcgcggca atttcccggt gttccgcaag agcctgcggc aatggacgat gcgcatcacc       780
     gagtacgccg accggctcat cgacgacctc gaccggctgg actggcctga gaaggtcaaa       840
     tccatgcagc gcaactggat tggccgctcc actggcgcgg tggtgtcctt cccatgcggc       900
     gagcaggtgt tggaagtctt caccacccgc ccggacaccc tctacggcgt cacattcctg       960
     gtcgccgcgc ccgaatcgga gctcgtcgcc agccttgtgc cgcaagcctg gccggtcggg      1020
     acggacccgc ggtggaccgg ctcggccgcg acgccggccg aggccgtcgc cacgtaccgg      1080
     gccaaggtcg cgaaccgggc cgaacgggag cgtcaggagg acaaagccaa gacgggcgtg      1140
     ttcacggggg cgttcgccgt caacccgctc acgcaggagc gcattcccgt cttcgtcgcg      1200
     gactacgtcc tcgccggtta cggcacgggc gttgtcatgg ccgtgccggg gcacgaccag      1260
     cgggactggg acttcgcgaa aaccttcggg ctgcccgtcg cggaggtggt ttccggcggg      1320
     gacgtcgaga tcggcgcgca caccggcgag gggcagctgg tgaactccgg gtcgtgggac      1380
     gggctttccg cgagcgaggc gaaggccgtc gctgccgacg atctcgagcg gctcggggtg      1440
     ggccgcaagc agctgcaata caagctgcgc gactggctct tcgcccgcca gcgttactgg      1500
     ggcgagccgt tccctctggt cgcggacgaa tccgggcagg tcttcccgct cgacgacacg      1560
     gccctgccgg tgctgttgcc gcaaatcgag gacttccggc ccatcgtctt cgacgccgac      1620
     gaccaagact cccgcccgtc cgccccgttg aaaaaagcgg gcgattggct cacggtggaa      1680
     tgcgacttcg gcgacggcgc gcagccgtac acccgcgaaa ccgacgtgat gccgaactgg      1740
     gccgggagct gctggtatta cttgcgctac ctcgacccga agaacgagga ggcgttctgc      1800
     gacccggaga acgaacgtta ttggatcggc ccgaggcccg acgcccgagg cggcgcagat      1860
     ccgggcgggg tggacctgta cgtcggcggg accgagcacg cggtgctgca cctgctgtac      1920
     gcgcggttct ggcacaaagt cctccacgac ctcggctacg tgtcttcggc ggagccgttc      1980
     cggcgtttgt tcaaccaggg ctacatccag gcgccctcgt acaccgactc ccgaggcgcg      2040
     tacgtccccg cggctgaggt cgaggagcgc gacggggagt tcttctggca ggggcaaccg      2100
     gtcaaacgcg agttcggcaa aatgggcaag agcctgaaga actcgatcac ccccgacgag      2160
     atctgcgacg agtacggcgc ggacacgctg cgggtctacg agatgtcgat gggccccttg      2220
     gaccagtcca aggactggtc caccaaggac atcgtcggcg cgcagcgctt cctcgccagg      2280
     gtgtggcgtg tcgtggtgga cgagcagtcc gggcaggcct gcgttgtcga cgcggagccg      2340
     gacgcagaga ctgtgcgcgc cttgcaccgc gccatcgacc aggtcggcca ggagtacgcc      2400
     gcgctgaagt tcaacttggc ggtggccaag ctcatcgagt acaccaacta cctcaccaaa      2460
     cgctatcttt ccggccagca gggcgcggaa ggcgcgccgc gcgccgcggt ggagccgctt      2520
     gtggtgatgc tcgccccgct cgccccgcac ctggccgagg agctgtggcg caggctcggg      2580
     cacgacgaac tgctggtgcg ccaccccttc ccgaccgccg acccggcgtt cctcgtggat      2640
     gacgaggtga agctcccggt gcaggtcgca ggcaaagtgc gcgccacgat cgtcgtgccc      2700
     gccggggttt cggaggacgt tgtccgcgcg gccgccctcg ccgaccccaa agtcgtggag      2760
     cacctggcgg gcaaggagcc caagcgggtc atcgtcgtgc cgaagaagat ggtcagcatc      2820
     gtgctgtga                                                              2829
//

If you have problems or comments...

PBIL Back to PBIL home page