(data stored in ACNUC7421 zone)

EMBL: CP001958.PE239

CP001958.PE239       Location/Qualifiers
FT   CDS_pept        221191..221634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0245"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: gbr:Gbro_3771 PPOX class putative F420-
FT                   dependent enzyme; TIGRFAM: putative F420-dependent enzyme;
FT                   PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96732"
FT                   /db_xref="GOA:D6ZAJ0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ0"
FT                   /inference="protein motif:TFAM:TIGR03618"
FT                   /protein_id="ADG96732.1"
FT                   /translation="MAEAHPEVTFAPEVRAFLEEGTRTGVVAWAGATGQPYAAPVWFVV
FT                   EQDVLLFTTMADSAKAKAMRRDPRIALTAQLSEPPYAYVQVRGIAELIEDLAEVRRVAT
FT                   LAGGRYMGQDRAEEFGERNGQPGEVVVRLRPTTVTAMLDVTAT"
     gtggccgagg cgcatcccga agtgacgttc gctcccgaag tgcgggcctt cctcgaagag        60
     ggcaccagga ccggggtcgt ggcgtgggcc ggggcgacag ggcagccgta cgccgccccg       120
     gtgtggtttg tggtcgagca ggacgtgctg ctgttcacca cgatggccga ctccgcgaag       180
     gccaaagcca tgcggcgcga tcctcggatc gcgctcaccg cgcagctctc ggagccccca       240
     tacgcctatg tgcaggtccg aggcatcgcc gagctgattg aggacctcgc ggaagtccgc       300
     cgggtggcaa ccctcgcggg cgggcggtac atgggccagg atcgggcgga ggagttcggc       360
     gagcgcaacg ggcagccggg cgaagtggtc gtccggttgc gtccgaccac cgtgacggcc       420
     atgctcgacg tgaccgcgac ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page