(data stored in ACNUC7421 zone)

EMBL: CP001958.PE24

CP001958.PE24        Location/Qualifiers
FT   CDS_pept        complement(25876..26169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0024"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: nfa:nfa14720 putative DNA-binding protein;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96517"
FT                   /db_xref="GOA:D6Z9J0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG96517.1"
FT                   /translation="MLAIYDSGTSPEISLKYRLLIARMEAGLEQSQLAERTGISVRTIR
FT                   NAERGHTSPKQHVIYQWALATGVPATWLLTGQDPNKNGGPDGPSAGTYGSSD"
     atgttagcca tttacgactc aggaacatcc cccgagatct ccttgaagta ccggcttctc        60
     atcgcacgca tggaagctgg actggaacaa agccagctcg cggaaagaac aggcatcagc       120
     gttaggacta tccgcaacgc ggaacgtggg cacacttccc caaagcagca cgtcatctat       180
     caatgggcgc ttgctaccgg ggttcccgcc acctggcttc tgactgggca agacccgaac       240
     aaaaacggtg gcccggacgg ccccagcgcg ggaacttacg gatcttcgga ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page