(data stored in ACNUC7421 zone)

EMBL: CP001958.PE244

CP001958.PE244       Location/Qualifiers
FT   CDS_pept        225570..226556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0250"
FT                   /product="fatty acid desaturase type 2"
FT                   /note="PFAM: fatty acid desaturase type 2; KEGG:
FT                   nfa:nfa6080 putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96737"
FT                   /db_xref="GOA:D6ZAJ5"
FT                   /db_xref="InterPro:IPR005067"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ5"
FT                   /inference="protein motif:PFAM:PF03405"
FT                   /protein_id="ADG96737.1"
FT                   /translation="MGADLDQSALLFELEEVAEREVNRHLAMAKDWHPHDYVPWSDGKN
FT                   FAALGGVDWDPEQSKLSDVAKAALVTNLLTEDNLPSYHNRIAGDLSPDGAWGTWVGRWT
FT                   AEEARHSTVMRDYLVVTRGVDPVALECDRMTHMTHGFQPLARFPHGTGAAFLHTVAYVS
FT                   FQELATRISHRNTGAICGDPIAEAIMQRLALDENLHMVFYRNICGAALDADPDQAMEAI
FT                   ANVVTNFQMPGSNMPNFRRHGVLMAKHGVYDLRQHLEEVLLPVIRTWRVFERADFTARG
FT                   EAARDRLAAYLEDLRTVQVPRFEEHRDRALARDKARGIDRALAPQAV"
     ttgggagcgg atttggatca gtcggcgttg ctgttcgagc tggaggaagt cgccgagcgg        60
     gaggtgaacc ggcacttggc catggccaag gactggcacc cgcacgacta tgtgccctgg       120
     tcggacggga aaaacttcgc ggcgctcggc ggcgtcgact gggacccgga gcagtccaag       180
     ctttccgatg tggccaaagc cgcgctggtc acgaaccttt tgactgagga caacttgccg       240
     tcgtaccaca atcggatcgc cggggacctt tccccggacg gggcctgggg cacatgggtc       300
     gggcggtgga ccgcggagga ggcccgccac tcgacggtga tgcgggacta tctcgtggtc       360
     acccggggcg tcgacccggt ggcgttggag tgcgaccgga tgacccatat gacgcacggg       420
     ttccagccgc tcgcgcggtt cccgcacggc acgggcgcgg cgttcctgca cacggtcgcc       480
     tatgtctcgt tccaggagct cgcgacgcgg atcagccacc gcaacaccgg cgcgatctgc       540
     ggcgatccga tcgccgaggc gatcatgcag cgtctcgccc tggacgagaa cctgcacatg       600
     gtcttctacc gcaatatttg cggcgcggcg ctcgacgccg acccggacca ggcgatggag       660
     gcgatcgcca acgtggtgac gaacttccag atgccggggt cgaatatgcc gaacttccgc       720
     cgccatggcg tgctcatggc caagcacggc gtctacgacc tgcgccagca tttggaagag       780
     gtgctcctgc ccgtgatccg cacatggcgc gtcttcgagc gcgccgattt caccgcgcgc       840
     ggcgaggcgg cccgcgaccg cctcgccgcg tatctggaag atctgcggac ggtccaagtg       900
     ccgaggttcg aggagcaccg cgaccgcgcg ttggccaggg acaaagccag ggggatcgac       960
     cgggcgctcg cgccgcaggc ggtgtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page