(data stored in ACNUC7421 zone)

EMBL: CP001958.PE245

CP001958.PE245       Location/Qualifiers
FT   CDS_pept        complement(226587..228251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0251"
FT                   /product="Pyruvate decarboxylase"
FT                   /EC_number="4.1.1.1"
FT                   /note="KEGG: mbt:JTY_0875 putative pyruvate or indole-3-
FT                   pyruvate decarboxylase; PFAM: thiamine pyrophosphate
FT                   protein TPP binding domain protein; thiamine pyrophosphate
FT                   protein central region; thiamine pyrophosphate protein
FT                   domain protein TPP- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96738"
FT                   /db_xref="GOA:D6ZAX9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAX9"
FT                   /inference="protein motif:PRIAM:4.1.1.1"
FT                   /protein_id="ADG96738.1"
FT                   /translation="MPQPYTIGHYLADRLAELGVRHVFGVPGDFNLMFLDRIVEHPGLA
FT                   WVGNVNELNAGYAADGYARMNGIAALVTTFGVGELSAVNATAGSYAEHVPVVHICGGPT
FT                   VDAQRARRSLHHSLGDGDFEHFLRIQREITCAQASLTPANATREIDRVLREVREQRRPG
FT                   YLLLPSDVAQVPSYPPAAPIPGPQDASSPGALAAFQEAAAKLLADKRPAVLADLLVHRF
FT                   GAVGELARLLDAGALPHATLLWGKSIVDELDPNFLGIYIGANSEPHVRAGVEEAEALIL
FT                   AGVQFTDFISGFFTQHLDVAKTVDIGPHESTVAGELFAPLEMRDALGALTELLSGRPRP
FT                   PEPAAPAPPAASAASPGEALTQASMWDLLAGAVTPGNIVIAEAGTSFFGLATHPLPAGV
FT                   TFIGQPLWASIGYTLPAALGAGLACPDRRVVLLIGDGSAQLTAQELSVIARYGLNAVIV
FT                   VVDNDGYTVERAIHGAQQPYNDIDHWDYAKLLSAFEPETEPLCLRVGTVGGLRAAIEET
FT                   EAAKDRLVLIEAVVAKMDMPPLLQKLGETMSEANTRA"
     atgccgcagc cgtacaccat cgggcattac ctcgccgacc ggctcgccga actgggcgtg        60
     cgccacgtct tcggcgtccc cggggacttc aacctgatgt tcctggaccg gatcgtggag       120
     caccccggcc tggcctgggt gggcaatgtg aacgagctga acgcgggcta cgcggcggac       180
     gggtacgcgc gcatgaacgg gatcgccgcc ctggtcacca cattcggggt gggggagctg       240
     tcggcggtga acgccacggc gggcagctac gccgagcacg tccccgtggt gcacatctgc       300
     ggcgggccga cagtggacgc gcaacgcgcc cggcgcagcc tgcaccattc cctcggcgac       360
     ggcgacttcg agcatttcct gcgcatccaa cgcgagatca cctgcgcgca ggcgagcctc       420
     accccggcga acgccacgcg cgagatcgac cgggtgctgc gcgaggtgcg cgagcaacgc       480
     cgccccggct acttgttgtt gccttcggat gtggcgcagg tgccgagcta cccgcccgcc       540
     gcgcccatcc cgggcccgca ggacgcgtcc agcccagggg cgctcgccgc gttccaggag       600
     gccgctgcga aactgctggc ggacaagcgc cccgcggtcc tcgccgacct gctggtgcat       660
     cgtttcggcg cggtgggcga gctcgcgcgg ctgctcgacg cgggcgcgct gccgcacgcg       720
     accctgttgt ggggcaagag catcgtggac gagctggacc cgaacttcct ggggatctac       780
     atcggggcga acagcgagcc ccatgtgcgc gcgggtgtgg aagaggcgga ggcgctgatc       840
     ctggccgggg tgcaattcac ggatttcatc agtggtttct tcacacagca cctggatgtg       900
     gccaaaacgg tggacatcgg cccgcacgag tcgacggtgg cgggcgagct gttcgcgccg       960
     ctggagatgc gcgacgcgct cggcgcgctc accgaactgc tctcgggccg cccccgcccg      1020
     cccgaaccag cagccccggc cccgcccgcg gcgtcggcgg cttcgccggg cgaggcgctg      1080
     acccaggctt cgatgtggga cctgctggcg ggcgcggtca cccccggcaa cattgtcatc      1140
     gccgaggcgg gcacttcgtt cttcggcctg gccacccacc cgctgcccgc cggggtcacc      1200
     ttcatcgggc aaccgttgtg ggcgtccatc ggctacaccc tgcccgcggc gctcggcgcg      1260
     gggctcgcct gcccggaccg gcgcgtggtg ctgctcatcg gcgacggctc cgcgcagctc      1320
     accgcgcaag agctttcggt gatcgcgcgc tacggcctca acgcggtcat cgtggtggtg      1380
     gacaacgacg ggtacacggt ggagcgcgcg atccacgggg cccagcagcc ctacaacgac      1440
     atcgaccact gggattacgc gaagctgctc agcgcgttcg aaccggaaac ggaacccctg      1500
     tgtttgcggg tcggcacggt cggcgggctg cgcgccgcca tcgaggaaac cgaggcggcg      1560
     aaggaccggc tcgtgctcat cgaggccgtc gtggcgaaaa tggacatgcc gccgctgttg      1620
     caaaagctcg gcgaaaccat gtcggaggcc aacacgcgcg catag                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page