(data stored in ACNUC7421 zone)

EMBL: CP001958.PE246

CP001958.PE246       Location/Qualifiers
FT   CDS_pept        228388..229284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96739"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96739.1"
FT                   /translation="MTQPHEKLPPARNPKPLEERIRILDEELPQLRVSGESACRRVFAT
FT                   VGHERALLELRLAWEALADEFELARGSRNEPLGHVALARIIETAVHAALAGYSQAVVDA
FT                   MHEPKPAGASLENQFYDEYWDLPEDERPDSVDDYIRQRKAELGGPVQPEDQYQADEAAA
FT                   QERIRAEVGSLADLDPDKLRVTESWMTDEAAELRERYAETVRKLQAFDPAGVRGVGKDN
FT                   PHNPIVKVTVSMASAFELELGERVWSDPGSRLGQAVVKAHAAARADFAAKMHDGGITLW
FT                   GDGRPDEEQPGGAPSRA"
     atgacgcaac cgcacgagaa gctgccgccc gcgcggaacc cgaaaccgtt ggaggagcgc        60
     atccgcatcc tcgacgagga gctgccgcag ttgcgcgtca gcggcgagtc cgcgtgcagg       120
     cgggtttttg cgaccgtcgg gcacgagcgc gccctgctcg aactgcggtt ggcctgggaa       180
     gccctcgccg acgagttcga gctggcgcgc gggtcgcgca acgagccctt ggggcatgtc       240
     gccttggccc ggatcatcga gaccgccgtg catgcggcgt tggccgggta ctcgcaggcc       300
     gtcgtggacg ccatgcacga gcccaagcct gcgggcgcgt ccttggagaa ccagttctac       360
     gacgagtact gggatctgcc cgaggacgag cgccccgact cggtggacga ctacatccgc       420
     cagcgcaagg ccgagttggg cggccccgtg caacccgagg accagtacca ggccgacgag       480
     gccgccgccc aggagcgcat ccgggccgaa gtcggcagtt tggcggattt ggaccccgac       540
     aaactgcggg tcaccgaatc gtggatgacc gacgaggccg ccgaattgcg ggagcgctac       600
     gccgagaccg tgcgcaagct tcaggctttc gaccctgctg gcgtgcgggg cgtcggcaaa       660
     gacaacccgc acaacccgat agtgaaggtc accgtgtcga tggcctccgc gttcgaacta       720
     gaactcggcg agcgcgtgtg gagcgacccc ggttcgcggc tcggccaggc tgtcgtcaag       780
     gcccacgcgg cggcccgcgc ggacttcgcc gcgaaaatgc acgacggcgg catcaccttg       840
     tggggcgacg ggcggcccga cgaagaacag cccggcggag cgccgagccg cgcctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page