(data stored in ACNUC7421 zone)

EMBL: CP001958.PE247

CP001958.PE247       Location/Qualifiers
FT   CDS_pept        229395..229871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS05355 putative methyl-accepting
FT                   chemotaxis transducer transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96740"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96740.1"
FT                   /translation="MNAVNPGNPGLKLTDIGGGASGRTNIDLDALGRVTLKMEPLRAEL
FT                   DGLIKQWDESTERYHAAAGSDDMNGNLKQQSTQAKQDADQHSKATSERAQKAADTSKEA
FT                   HAQYSGVEDDNHTELKKPGDHLSGGGGANFNAPAATQAGADSNASAATGGPVAR"
     atgaacgctg tgaatccggg gaatcccggc ttgaagctca ccgatatcgg tggtggagcc        60
     tcgggccgca cgaatatcga tttggacgcc ctggggcgtg tcaccctcaa gatggagccg       120
     ttgagggcgg agctggacgg cttgatcaag cagtgggacg agtccaccga gcgttaccat       180
     gcggctgcgg gctcggacga catgaacggc aacttgaaac agcagtcgac ccaggccaaa       240
     caggacgccg atcagcacag caaagccacc agcgagcgcg cgcaaaaggc tgcggacacc       300
     tcgaaagagg cccatgcgca gtactcgggc gtcgaggacg acaaccacac agagctcaag       360
     aaacccggcg accacctgtc cggcggcggc ggggcgaact tcaacgcccc tgcggcgacc       420
     caggcgggcg cggactccaa cgcgtccgcc gcaacgggcg gcccggttgc ccggtag          477
//

If you have problems or comments...

PBIL Back to PBIL home page