(data stored in ACNUC7421 zone)

EMBL: CP001958.PE25

CP001958.PE25        Location/Qualifiers
FT   CDS_pept        26293..26502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0025"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: nfa:nfa14730
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96518"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J1"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG96518.1"
FT                   /translation="MPHSEDLLSITDVVEQTGISRRTILYHIHKGRLTAEPRPSGGRGA
FT                   WLIAPLELRKYLESQDQCAVKQSA"
     atgccgcaca gcgaagacct cctttcgatc acggatgtgg tcgagcagac gggcatctcg        60
     cggcgaacca tcctctacca catccacaaa gggcgactga cggcagaacc gcgcccctct       120
     ggtggacgcg gggcatggct catcgcacca cttgaactgc gtaaatacct ggaatcacag       180
     gatcaatgcg ccgtgaagca gagcgcgtga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page