(data stored in ACNUC7421 zone)

EMBL: CP001958.PE251

CP001958.PE251       Location/Qualifiers
FT   CDS_pept        235137..235616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa27930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96744"
FT                   /db_xref="GOA:D6ZAY5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96744.1"
FT                   /translation="MADTPYEGMTSAEVNAKFNRDIERRLAELDEAERALTAIRGVGEA
FT                   EHGSVRVEVDSNGMIVDIKLADRAMHLGSPKLERAVLLALTKAKNAAIAAGEAPFSTVV
FT                   GDEEARDYTEKRLEPEPEEEPKGGALWGENGNQRRWAPDPDEEEEEYDWRRDLRR"
     atggcggaca ctccctatga aggcatgaca agtgcagagg ttaacgctaa gttcaataga        60
     gatatcgagc gaaggctcgc tgagctagat gaagctgaac gtgctttaac agccattcgc       120
     ggcgtcggag aggcggagca cggctccgtg cgggtcgaag tcgactcaaa cgggatgatt       180
     gtcgatatca agctcgcgga tcgcgctatg catctcggtt cgccaaagct ggagcgggcg       240
     gtgctactcg ccctgaccaa ggcgaagaat gcagccatag ctgctggcga agctccgttc       300
     tcaacggttg tcggggatga agaggctcgt gactataccg agaaacggct tgagccggag       360
     cctgaggagg agccaaaggg aggggcgctc tggggcgaga acggtaatca gcggcgctgg       420
     gccccggacc ccgacgaaga ggaagaagaa tacgactggc gcagggatct gcggcgctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page