(data stored in ACNUC7421 zone)

EMBL: CP001958.PE253

CP001958.PE253       Location/Qualifiers
FT   CDS_pept        235973..236845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drt:Dret_0495 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96746"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96746.1"
FT                   /translation="MPGTLLSDAVQCKKDVQDFVTKLKALNLAQHSDKTREIDAFDGAV
FT                   SDGDFFMSISKDVIDWLMKNVEQFKHVVDIITMDEKKADSIVHDWSDAFPKELAHHADD
FT                   LKSLGKQIAADWGSSTIPGLNFDSTGLDTMASTFGQLQDGVSGPPGSADHPTWFVVRQT
FT                   ALAEILIVSGDACLAVGELINKVNDLIKKMIKKIKDGLAKLLLAVVNKILTAIAEKIPG
FT                   VGWLMEGIDVIANHSDALTRLIRDITDVIKELMKYKDAVWEALKEADAIVRAGEKVFKD
FT                   VGNLQSHFK"
     atgcctggaa cactattatc agacgctgtg caatgtaaga aggacgtgca ggattttgtc        60
     acgaagctca aagcgttgaa tcttgcccag cactccgaca agacgaggga gatcgacgct       120
     tttgacggtg ctgtctctga cggagatttt ttcatgtcca tcagcaagga tgtgatcgat       180
     tggttgatga agaatgtcga gcaattcaag catgtcgttg acataattac catggatgag       240
     aaaaaagctg actccattgt ccatgattgg tcggatgcct tccccaagga gctggcccac       300
     cacgctgatg acttgaagag cttgggcaag cagatcgcgg cagactgggg ttcaagcacg       360
     ataccagggt tgaatttcga cagcacgggc ttggacacga tggcaagcac gttcggccaa       420
     ttgcaagacg gagtgagcgg ccctccgggc agcgctgacc acccaacatg gttcgttgtg       480
     aggcagacgg cacttgctga gatcctgatc gtgtcgggag atgcctgctt ggccgtcgga       540
     gaactcatca acaaagtcaa cgatcttatt aaaaagatga tcaaaaagat caaagacggc       600
     cttgcgaaac tgttgcttgc tgtggttaac aagattttaa ctgccatagc ggagaaaata       660
     ccgggcgttg gctggctgat ggagggcata gatgtgatcg cgaaccattc ggacgcgctc       720
     acgcggctga tccgcgatat cacagatgtc ataaaagaat tgatgaagta caaagacgcg       780
     gtctgggaag cgctgaagga ggcggacgct atcgtcagag caggtgagaa ggtgttcaaa       840
     gacgtgggga acctgcagag ccatttcaag taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page