(data stored in ACNUC7421 zone)

EMBL: CP001958.PE256

CP001958.PE256       Location/Qualifiers
FT   CDS_pept        238138..239139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdi:DIP1084 iron ABC transporter membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96749"
FT                   /db_xref="GOA:D6ZAZ0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96749.1"
FT                   /translation="MDELLWFGLSEQAWLSVVVAASLAISLVVTLVSRAVVDPEVVAQG
FT                   TGFFGGDSLELRSVWGRGALLCMGLVLCGAVVVVSDGGLDTLVLFSLFATLVVLAVELL
FT                   FPGALTPGAVGDVDRFSTRRDGTLVRGVALRAKFSHRIAEGIAFLFFSGALLGFAAKAW
FT                   GDPWAFLEGKSSFERWLVIALPGVLGALGFTAALFALFDGEYEQNLLVMTPDWFSFPAD
FT                   SKKSVKTIMWRDVCEMRRCEDEDIVAYSVEDEAGNDRTVHVSRAGDYLAAFDVNGAVLG
FT                   RMLLTGLPRKDQFEKVLTSLWNEPQRRARLAGQDAVAWVRQLAEREAGRTSE"
     atggacgagc tgctttggtt cgggttgtct gagcaagctt ggctcagtgt cgttgtcgcg        60
     gcgtccctgg cgatatcgct tgtcgtgaca ctggtttcac gggcggtggt cgatcccgag       120
     gtcgtggcgc agggcaccgg tttcttcggc ggcgacagcc tggagctgcg gtctgtgtgg       180
     gggcgagggg ctttgctctg catgggtttg gtgttgtgcg gcgcggttgt cgtcgtgtcc       240
     gacggcgggc tggacacgct ggtcctcttt tcgctcttcg cgacgttggt cgttctcgcg       300
     gtggaacttc tcttcccggg cgcgctcacg ccaggagccg tcggggacgt ggatcggttt       360
     tccacgcgac gtgacggcac actcgtccgc ggggttgcgc ttcgtgcgaa attcagccac       420
     agaatcgcgg aagggatcgc gttcttgttc ttcagcggcg cgctcttggg tttcgcggcg       480
     aaagcatggg gcgacccatg ggcgttcctc gaaggaaaaa gctcattcga gagatggctg       540
     gtgatagctt tgcccggtgt gctgggcgcg ctcgggttca ccgccgcgct tttcgccctg       600
     ttcgacggcg agtacgagca gaaccttctc gtcatgaccc cagactggtt ctcatttccg       660
     gccgattcga aaaagagcgt caagaccatc atgtggcggg acgtctgtga gatgcggcgt       720
     tgcgaagatg aagacatcgt tgcgtacagc gttgaagacg aagcgggcaa cgaccgcaca       780
     gtccacgtct cgcgggcagg cgactacctt gcagcgttcg atgtgaacgg ggctgtcctc       840
     ggcaggatgc tcctgacggg attgccgcgc aaagatcagt ttgaaaaagt gctcacatcg       900
     ttgtggaacg agccgcagcg gcgagcccgt ctcgcagggc aggacgccgt cgcatgggtc       960
     cggcagctgg cggagcgtga agctgggcgc acttctgaat ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page