(data stored in ACNUC7421 zone)

EMBL: CP001958.PE262

CP001958.PE262       Location/Qualifiers
FT   CDS_pept        complement(242952..243626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96755"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96755.1"
FT                   /translation="MRKKLLAAMAAVAGAAALAAAPARADRQSVCETVDGLWSERSEFV
FT                   QITGRAACELTPETPGSTFLQLQYEYPSDVADDAAGSKQLAAWLKSRIAVYQGQLAGAR
FT                   DGDERQIAVGATYEEQSAGAARTVVFTETAFTKGNRQPVTQKLTQTFTLSAPPPVAGAP
FT                   DGAAPDSAAPAPGAPVPGAPAPAVPPIAAPASPATTAPAAPAPATPAASAKPPKTSVKP
FT                   LR"
     atgcgaaaga aactgttggc agcgatggcc gccgtcgcgg gcgcggccgc gctggcggcg        60
     gcccccgcgc gcgccgaccg gcaaagcgtg tgcgaaacgg tggacggctt gtggtctgag       120
     cgcagcgagt tcgtgcagat caccggcagg gccgcgtgcg agctgacccc ggagacgccg       180
     ggcagcacct tcttgcagct gcaatatgag tacccgagcg atgtggcgga cgacgccgcg       240
     ggcagcaagc agctggccgc gtggctgaag tcccggatcg ccgtctacca aggacagctc       300
     gcgggcgcgc gcgacggcga cgaacggcag atcgccgtcg gggccactta tgaggagcag       360
     tcggccggag cggcgcggac ggtggttttc accgagaccg cgttcacgaa ggggaaccgg       420
     cagcccgtga cgcaaaaact cacccagacg ttcaccctgt ccgcgccccc gccggtggcc       480
     ggggcccctg acggcgctgc cccggacagc gctgcgcccg cgcctggcgc ccccgtgcct       540
     ggggctccgg cgcccgccgt cccgccgatc gccgcgccag catcgccagc caccaccgcg       600
     cccgccgccc cggcccctgc cacgcctgct gccagcgcga agccgcccaa gacgagcgtc       660
     aaaccgctcc gctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page