(data stored in ACNUC7421 zone)

EMBL: CP001958.PE263

CP001958.PE263       Location/Qualifiers
FT   CDS_pept        complement(243694..244401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_1497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96756"
FT                   /db_xref="GOA:D6ZAZ7"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ7"
FT                   /inference="similar to AA sequence:KEGG:SACE_1497"
FT                   /protein_id="ADG96756.1"
FT                   /translation="MRRETQHLILLLLGGAVLKISLNGNYARYVKPALGPWLTATGAAA
FT                   VLLAVALIAASFRSKPTEHEHEHEHHHSSRMAWLLMVPALVLLFAPPPVLTVDQPPAQA
FT                   QAAPADPAPYPPLPPGQPSMKLIDFVGRALGAPATLDGREVSLVGFVRKLPDGLYLARV
FT                   FIWCCAADARSVVLKLDVDPARAPAQDLADKQWVRLIGTYVPGSIDNDPEDIPTVRVIH
FT                   VAPIPPPENPYET"
     gtgcgccgag agacacaaca cttgatcctg ctgctgctgg gcggggccgt gctcaagatc        60
     tcgttgaacg ggaactatgc gcggtatgtg aaacccgcgc tcgggccgtg gctcacggcg       120
     accggcgcgg cggccgtgct gctcgcggtg gcgctcatcg cggcgagttt tcgcagcaag       180
     cccacagagc acgagcacga gcacgagcac catcattcga gccggatggc gtggttgttg       240
     atggttccgg cgttggtgct gctcttcgcg ccgccgccgg tgttgaccgt ggaccagccg       300
     cccgcgcagg cgcaggcggc tccagccgac ccggccccct acccgccgct gcccccgggc       360
     caaccgtcga tgaagctgat cgacttcgtc ggccgggcgc tcggggcccc ggccacgctc       420
     gacggcaggg aggtctcgtt ggtcggtttc gtccggaaac tccccgacgg actctatttg       480
     gccagggtgt tcatctggtg ttgcgcggcg gacgcgcgct cggtggtgct caagctcgac       540
     gtggaccctg cccgcgcccc cgcgcaggac ctcgccgaca aacagtgggt gcggctgatc       600
     gggacatacg tgccgggcag catcgacaac gacccggagg acattccgac cgtgcgcgtc       660
     atacacgtcg cgcccatccc gccgcccgag aacccgtacg agacctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page