(data stored in ACNUC7421 zone)

EMBL: CP001958.PE265

CP001958.PE265       Location/Qualifiers
FT   CDS_pept        245481..246686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0271"
FT                   /product="secretory lipase"
FT                   /note="PFAM: secretory lipase; KEGG: rop:ROP_51020
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96758"
FT                   /db_xref="GOA:D6ZAZ9"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ9"
FT                   /inference="protein motif:PFAM:PF03583"
FT                   /protein_id="ADG96758.1"
FT                   /translation="MASSVPFVLAVCGLGACGQDKAAPPPPPPPAPPSAPPNTTTTPTS
FT                   VPPGTKLSSQEAPADWKRLLPPGADATLIRYRSVSGLDGSATEVGGVVLTPAGPAPKEG
FT                   WPIITVGHGLTGVRGDCGAAEHPLLASVTKRLAPLVKAGYLVVMSDYQGLSSAGTHPFL
FT                   DPKTAAYNLIDAVAAARQLVPQHSNKWAAMGHSQGGQAAWAALEHAKEYGKSFQFVGAV
FT                   ALAPAVNGAAAFDAALHGKLTKLQESLFPALIAGYLARHPDGKWEDFLSGALLENHDVL
FT                   LSCAPEDMQKRAAVLSRITPGDVVPDTEQAQAKLRAWLEEVSLPKTAGDGPLLVVQGAK
FT                   DELIEPEWTREAVRQGCALGLRVQEIVRPGQGHADVEDDKDVLDWLGARFAGDQPAPTS
FT                   CE"
     gtggcctcat cggttccgtt cgttttggcc gtgtgcggcc tgggcgcctg cggccaggac        60
     aaagccgctc cgcccccgcc tcctccgccc gccccgccct ccgcgccccc gaacacgacc       120
     acgacgccga cgagcgtccc gcccggcacg aagctctcct cgcaggaggc tcctgccgac       180
     tggaagcggc tcctcccgcc gggcgcggac gcgacgctga tccgctatcg ctccgtctcg       240
     ggccttgacg gctccgcgac cgaggtcggc ggcgtcgtcc tcacccccgc cggacccgcc       300
     ccgaaagagg ggtggcccat tatcaccgtc ggccacggcc tgaccggtgt gcgcggggac       360
     tgcggggctg ccgagcaccc gctgctcgcc agcgtcacca agcggctcgc cccgctggtc       420
     aaagcgggct acctggtcgt gatgagcgat taccaagggc tttcctcggc gggcacgcac       480
     ccgttcctgg accccaagac cgccgcgtac aacctgatcg acgcggtcgc cgccgcgcgc       540
     cagctcgtcc cgcaacactc caacaaatgg gccgcgatgg gccattccca aggcggccaa       600
     gccgcatggg cggccttgga gcacgcgaag gagtacggca aatcgttcca gttcgtcggc       660
     gctgtcgcgc tcgcccccgc ggtcaatggc gcggcagcct tcgacgcggc gctccacggc       720
     aagctgacca agctgcagga gtcgctgttc ccggctctga tcgccgggta cctcgcgagg       780
     caccccgacg gcaaatggga ggatttcctg tccggggcct tgctggagaa ccacgacgtt       840
     ttgctctcct gcgccccaga ggacatgcag aaacgagccg ctgtcctctc ccggatcacc       900
     cctggcgacg tggtgccgga cacggagcag gcgcaggcca agctccgggc ctggctggag       960
     gaggtctcct tgcccaaaac ggcgggggac gggccgctgt tggtcgtgca gggggccaag      1020
     gacgagctca tcgagcccga atggacgcgg gaggcggtgc ggcagggctg cgcgctgggc      1080
     ttgcgcgtgc aggagatcgt ccgccccggc caagggcacg ctgacgtcga agacgacaaa      1140
     gatgtgctgg actggctcgg ggcgcgcttc gccggggacc agccggcgcc cacgagctgc      1200
     gagtag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page