(data stored in ACNUC7421 zone)

EMBL: CP001958.PE269

CP001958.PE269       Location/Qualifiers
FT   CDS_pept        complement(249488..250582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0275"
FT                   /product="inositol 1-phosphate synthase"
FT                   /note="KEGG: mab:MAB_4907 myo-inositol-1-phosphate
FT                   synthase; TIGRFAM: inositol 1-phosphate synthase; PFAM:
FT                   Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96762"
FT                   /db_xref="GOA:D6ZB03"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB03"
FT                   /inference="protein motif:TFAM:TIGR03450"
FT                   /protein_id="ADG96762.1"
FT                   /translation="MSENANEVRVAIVGVGNCAASLVQGVQYYQDADEDATVPGLMHVR
FT                   FGPYHVRDVKFVAAFDVDAKKVGFDLSEAIFASQNNTIKISDVPPQDVTVLRGPTLDGL
FT                   GKYYMQTIEEAPGEAADVVAALKAAKADVLVSYLPVGSEEADRFYAQCAIDAGVAFVNA
FT                   LPVFIASDPVWAKKFEDAGVPIVGDDIKSQVGATITHRVMAKLFEDRGVVLDRTYQLNV
FT                   GGNMDFKNMLERDRLESKKVSKTQAVTSNLQGSLAGKVYDRNVHIGPSDYVEWLDDRKW
FT                   AYVRLEGRAFGDVPLSLEYKLEVWDSPNSAGIIIDAVRAAKIALDRGIGGPVYPASAYL
FT                   MKSPPRQLADDVARAQLETFISGE"
     atgagcgaga acgcgaacga agtccgagtt gcgatcgtcg gcgtcggcaa ctgcgccgcg        60
     tccctggtcc aaggcgtgca gtattaccag gacgccgatg aggacgcgac cgtccccgga       120
     ctgatgcacg ttcgtttcgg cccctaccac gtccgcgacg tgaagttcgt cgccgcgttc       180
     gacgtggacg ccaagaaagt gggcttcgac ctttccgagg ccatcttcgc gagccagaac       240
     aacaccatca agatctccga cgtgccgccc caggacgtga ccgttctgcg cggccccacc       300
     ctcgacgggc tcggcaagta ctacatgcag accatcgagg aggccccggg cgaggcggcc       360
     gacgtggtcg ccgccctcaa ggccgccaaa gccgatgtgc tggtctcgta cctgccggtg       420
     ggctccgagg aagcggaccg cttctacgcc cagtgcgcca tcgacgccgg ggtggcgttc       480
     gtgaacgccc tgccggtctt catcgcctcc gacccggtgt gggcgaagaa gttcgaggac       540
     gcgggcgtgc cgatcgtcgg cgacgacatc aagagccagg tcggcgccac catcacccac       600
     cgcgtgatgg cgaagctctt cgaagaccgg ggcgtcgtgc tggaccgcac ctaccagctc       660
     aacgtcggcg gcaacatgga cttcaaaaac atgctggaac gcgaccggtt ggagtccaag       720
     aaggtctcca agacccaggc cgtcacgagc aacctgcagg ggtcgctggc gggcaaggtc       780
     tacgaccgca acgtccacat cggcccgtcc gactacgtcg aatggctcga cgaccgcaag       840
     tgggcgtacg tgcgccttga aggccgggcc ttcggcgacg tgccgctgag cttggagtac       900
     aagctcgaag tgtgggactc gccgaactcc gcggggatca tcatcgacgc ggtgcgggcc       960
     gcgaagatcg ccctcgaccg gggcatcggc ggcccggtct acccggccag cgcctacttg      1020
     atgaagtccc cgccgcgcca gctcgccgac gacgtcgccc gcgcccagtt ggagaccttc      1080
     atctccggcg agtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page