(data stored in ACNUC7421 zone)

EMBL: CP001958.PE270

CP001958.PE270       Location/Qualifiers
FT   CDS_pept        complement(250579..251151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0276"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: rha:RHA1_ro03446 PadR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96763"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB04"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADG96763.1"
FT                   /translation="MLEMAILGLLHDSSIHGYDLRKNLRELLGPFRAFSYGSLYPALKR
FT                   MEAEGLIGSEDAAPPPSARSALAGSTSVGSKRAKRVYEITPEGRERFIELVSDTGPRNY
FT                   TDDGFGLRLAFFRFTTPEVRMRILEGRRRQVEQRRDTLRETLAKASAGLRRYTAQLQQL
FT                   ALESTEREVGWLNELIAAEIRGESHQA"
     atgttggaga tggcgatcct cggattgctc catgactcct ccatacatgg ctacgacctt        60
     cgcaaaaacc tccgagagct gctcggtccg tttcgggcct tctcgtacgg gtccctgtac       120
     ccggccttga agcgcatgga ggcggagggt ttgatcggct cggaggacgc cgcgccgccg       180
     ccctccgccc gcagcgcgct ggccggctcc acgtccgtgg gcagcaagcg ggcgaagcgg       240
     gtctacgaaa tcaccccgga agggcgggaa cgcttcatcg aattggtgag cgacaccgga       300
     ccccggaact acacggacga cggctttggc ctgcggttgg cattcttccg cttcaccacg       360
     cccgaggtgc gcatgcgcat tctcgaaggc cgccgccggc aggtggagca acgtcgcgac       420
     accctgcgcg agaccttggc gaaagccagc gccggcctgc gccggtacac agcccagctg       480
     caacagctgg ccctggagtc cactgaacgc gaagtgggat ggctcaacga gctcatcgcc       540
     gctgagatcc gaggagagag ccaccaagca tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page