(data stored in ACNUC7421 zone)

EMBL: CP001958.PE279

CP001958.PE279       Location/Qualifiers
FT   CDS_pept        257377..258834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0285"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: rha:RHA1_ro03428
FT                   replicative DNA helicase; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96772"
FT                   /db_xref="GOA:D6ZB13"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB13"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ADG96772.1"
FT                   /translation="MPMPVGESRERVGLVRAEDAPREDHGLGSAVASRDRGPSSDGPYD
FT                   AGRQPPQDAVAEQSVLGGMLLSKDAIADVLEHVQGKDFYRPAHQLVFDAILELFGRGEP
FT                   ADAVLVAAELERKGHLGRIGGAPYLHTLISSVPTAANASYYAEIVAEKAIMRRLVEAGT
FT                   RIVQYGYGGADGQDAAEVVDRAQAEIFDVTQRKRADEVVALEDLLQPTMDEIDSIASRG
FT                   GISLGVPTGFADLDKVTNGFHPGQMIIVAARPGVGKSTLALDFLRSCSVQNGLASALFS
FT                   LEMSKMEIVMKLLSAEARIRLADMRSGRMSDDDWSRLARRMSQISEAPLFIDDSPNLTI
FT                   MEIRAKARRLKQRHDLKLVVVDYLQLMTSGKKVESRQQEVSEFSRQLKLLAKELEVPVV
FT                   ALSQLNRGPEQRTDKRPMVSDLRESGSLEQDADMVILVHRPDAIEPDDPRGGEADLILG
FT                   KHRNGPTCTITVAHQLHVSRFVDMARG"
     atgccaatgc ctgtgggcga gtccagggaa cgggtcggcc tcgtgcgcgc cgaggatgcc        60
     cctcgtgagg accacggtct cggatccgca gtcgcctccc gggaccgggg gccgagctcc       120
     gacgggccgt acgacgcggg ccgccagccg ccgcaggacg ccgtcgcgga gcaatccgtg       180
     ctcggcggca tgctcctgtc gaaagacgcc atcgccgacg tgctcgaaca cgtccaaggg       240
     aaggacttct accgtcctgc ccaccaattg gtcttcgacg ccatcttgga gctgttcggg       300
     cggggcgagc ccgcggacgc ggtgctcgtg gccgccgagc tggagcgcaa agggcatctc       360
     gggcggatcg gcggagcccc gtacctgcac acactgatat cgagcgtccc cacagcggcg       420
     aacgcgtcct actacgccga aatcgtcgcc gagaaggcga tcatgcgcag gctcgtcgaa       480
     gcgggcaccc gcatcgtgca gtacggctac ggcggggcgg acggccaaga cgccgccgaa       540
     gtcgtggacc gggcgcaagc ggagatcttc gacgtcaccc aacgcaaacg cgccgacgaa       600
     gtcgtggcgc tcgaagacct gctccaaccc accatggacg agatcgactc catcgcgagc       660
     cgcggcggga tctcgctcgg cgtgcccacc gggttcgccg acctcgacaa ggtgaccaac       720
     ggcttccatc ccggccaaat gattatcgtc gcagcccgcc ccggcgtcgg gaaatccacc       780
     ctcgcattag acttcctgcg gtcctgctcg gtgcagaacg gcctggccag cgccttgttc       840
     tccctggaga tgagcaagat ggagatcgtc atgaaactcc tctccgccga ggcgcggatc       900
     cgtctcgccg acatgcgctc gggccggatg agcgacgacg actggagccg cctcgcccgg       960
     cggatgagcc aaatcagcga ggcgcccctg ttcatcgacg actcgccgaa cctcaccatc      1020
     atggagatcc gcgccaaagc gcgcagactc aagcagcgcc atgacctcaa gctcgtcgtc      1080
     gtcgactacc tccagctcat gacctccggc aaaaaggtgg agtcccgtca gcaagaagtg      1140
     tccgaattct cccgtcagct caaactgctc gccaaagagc tcgaagtccc cgtcgtcgcg      1200
     ctcagccagc tcaaccgcgg ccccgagcag cgcaccgaca aacggcccat ggtctcggac      1260
     ctgcgcgagt cgggctcgtt ggagcaggac gccgacatgg tgatcttggt gcaccgcccg      1320
     gacgccatcg agccggacga cccccgaggc ggcgaggcgg acctcatcct cggcaagcac      1380
     cgaaacggcc cgacctgcac cataacggtc gcccaccagc tgcacgtctc ccggttcgtg      1440
     gacatggcac ggggctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page