(data stored in ACNUC7421 zone)

EMBL: CP001958.PE282

CP001958.PE282       Location/Qualifiers
FT   CDS_pept        259507..260196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lcb:LCABL_21960 peptidoglycan lytic protein
FT                   P45"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96775"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96775.1"
FT                   /translation="MADTGKEILDSGHVPVNGQQTEALAALRQYFDILLLHWVRLAACG
FT                   VSFAGLDPNRGGGYYTQAYHAEDDIDLKAFRDTSQTLRTAGAGTQTQLDLIAQTENLHH
FT                   HWNDPASDAALHNYLTNKDRMEQDQSDLVAHQQNIAQVAENLQKALEAKRDMAVNAVDK
FT                   LVNQALRNSPGISRTGCAPPASRWSPTTRAAASAASASTSTSTSTTGPPARTGTPTTCG
FT                   ATSRTAW"
     atggccgaca cgggcaagga gatcctcgac agcggccacg tgcccgtgaa cggccaacag        60
     acggaggcgc tcgcggcgct gcgccagtac tttgacatcc tgctgctgca ctgggtcagg       120
     ctcgcggcct gcggtgtcag tttcgccggg ctcgacccga acaggggcgg cggctattac       180
     acgcaggcgt accacgccga ggacgacatc gacctcaaag cattccggga cacatcccag       240
     acgctgcgca ccgcaggcgc gggcacacag acgcagctcg acctgatcgc acagaccgag       300
     aacctgcacc accactggaa cgaccccgct agcgacgcgg ccctgcacaa ctacctgacc       360
     aacaaagacc gcatggagca ggaccagagc gatctcgtcg cccaccagca gaatatcgcg       420
     caggtggccg agaacctgca gaaagcgctg gaagccaaac gcgacatggc ggtcaacgcc       480
     gtcgacaagc tggtcaacca ggcgctgcgc aacagccccg ggatttcgag aaccggctgc       540
     gcaccgcctg cgagtcgatg gagtccaaca accagggcgg cggcatcggc ggcttcggct       600
     tccaccagca cctctaccag caccacgggg cccccggcga gaactggaac gccaacgacg       660
     tgcggggcga catccagaac agcgtggtga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page