(data stored in ACNUC7421 zone)

EMBL: CP001958.PE284

CP001958.PE284       Location/Qualifiers
FT   CDS_pept        260999..262201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_5771 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96777"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96777.1"
FT                   /translation="MRLTHTWFSALAAAFALASCHAPDDGQGSSSSAQHHAVGASTAAT
FT                   APLPTDFPGIPAGAVVAYHDGDGVKVITAIPAATQASFGAKDTGAPSFTADGKHVFASV
FT                   GKANRQDADQILDFDVATRTVRSIACPCAKAVAASGSMLVWWEDPDRLMSLDLREPDPK
FT                   PKILRTVQLPTPAPDKIQGELSWQPSGTAVIGASRDIVLIGRLPTKPLPTGGPTYLFTV
FT                   QDDGTARSLGAANSDGPVTRALFSPGGKQFAYIGRYRASSNSRSASVSIVDTSTWQTQT
FT                   PSIADSSSPGVVPGVTSLWWDSDGALDTVYYSDKEGSPSPMTTVTPPNIWTLTDQTWKQ
FT                   IGFDGERWLYHLAPGAILTLGRSNPRDEHSVSTTLSMEVQGRRAQIAEGVTAVAAMSAR
FT                   Q"
     atgagactga cgcacacctg gttctcggcg ctggccgccg ccttcgcgct cgccagctgc        60
     cacgctccgg acgacggcca gggctcctcg tcgagcgccc agcaccacgc cgtgggcgca       120
     tcgaccgccg cgacagcgcc gctgccgaca gacttccctg gcatacctgc gggagcggtc       180
     gtcgcgtacc acgacggcga cggcgtcaaa gtcatcaccg cgatcccagc tgctacgcag       240
     gcgagcttcg gggcgaaaga caccggagcc ccgtccttca ccgccgatgg gaagcacgtg       300
     ttcgcgagcg tcggcaaggc gaacaggcaa gacgctgatc agatcttgga cttcgatgtg       360
     gccacccgga ccgtcagatc catcgcgtgc ccgtgcgcga aggccgtggc ggcaagcggc       420
     agcatgcttg tctggtggga agaccccgac cgcctcatga gtctcgatct gcgcgagccg       480
     gatccgaagc caaaaatatt gcgcaccgtg cagctcccga cccccgcccc cgacaaaatc       540
     cagggcgaat tgtcatggca acccagcggc acagccgtca tcggcgccag cagggacatc       600
     gtgctcatcg gcagactccc cacgaaaccc cttcccactg gaggcccgac ctacttgttc       660
     actgtgcagg acgatggcac agcccgatcg ctcggagcgg cgaactccga tggtccggtg       720
     acccgcgcgc tcttcagccc cggcgggaaa caattcgctt atatcggcag gtatcgggcg       780
     agctcaaact cccgatccgc gtccgtgtcg atcgtcgaca cctcgacctg gcagacacag       840
     accccgtcca tcgcagacag ctccagtccg ggcgtcgtcc ccggtgtgac cagtctctgg       900
     tgggattccg acggagcgct cgacaccgtc tattacagcg acaaagaagg ctcgcccagc       960
     ccgatgacga ctgtcacccc gccgaacatc tggacgctca ccgaccaaac atggaagcag      1020
     atcggcttcg acggggaacg atggttgtac cacctagctc ctggcgcgat cttgacgctc      1080
     gggcgttcca accccaggga cgagcacagc gtcagcacga ccctctccat ggaggtccaa      1140
     gggcgtcgcg cgcagatcgc agagggcgtc acagcagttg cggcgatgtc cgcaaggcaa      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page