(data stored in ACNUC7421 zone)

EMBL: CP001958.PE286

CP001958.PE286       Location/Qualifiers
FT   CDS_pept        complement(265084..265476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0292"
FT                   /product="membrane family protein"
FT                   /note="PFAM: membrane family protein; KEGG: mmi:MMAR_3049
FT                   membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96779"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB20"
FT                   /inference="protein motif:PFAM:PF05423"
FT                   /protein_id="ADG96779.1"
FT                   /translation="MVIAAAASTVAVLRLRAEFGADETRLSQPGNLESIVPITPKTVVY
FT                   EVFGATQARGKVSYVDEHAQPKNASFTALPWSRTITTMAPVVFANLVAQGESGSIGCRI
FT                   RVNGEIQDERTASGQGAQVSCLVKAG"
     gtggtgatcg cggcggcggc cagcacggtc gccgtcctcc gcctgcgcgc cgaattcggg        60
     gctgacgaaa cccgtctgtc gcagcctggg aacttggaga gcatcgtccc gatcacgccg       120
     aaaaccgtcg tctacgaggt cttcggcgcg actcaggccc gcggcaaggt cagctacgtg       180
     gacgagcacg cccagccgaa aaacgcgagt ttcacggccc tgccgtggtc gcgcacgatc       240
     acgacaatgg ccccggtcgt gttcgccaac ctcgtggcac aaggcgagag cgggagcatc       300
     ggctgccgca tccgggtgaa cggcgaaatc caggacgagc gcacggcgag cggccaaggg       360
     gcgcaggtct cctgcctggt gaaagccgga tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page