(data stored in ACNUC7421 zone)

EMBL: CP001958.PE287

CP001958.PE287       Location/Qualifiers
FT   CDS_pept        complement(265562..266722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0293"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mab:MAB_4743c putative
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96780"
FT                   /db_xref="GOA:D6ZB21"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB21"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG96780.1"
FT                   /translation="MDRKRIVVLGAGIGGLSVVKELRESRAPLDDVDVVLVDQNFEHYL
FT                   GFTLPWVMRGWRDEQSVPIRPTQNALDGLTTVQGKVVGVDPAHKTVALDDGAQLGFDAL
FT                   VLALGAQNTPGEVPGLHEALDAGSAVHYYSAAEAGRAHRALQHFDGGKLVFLVASQPYR
FT                   CPVAPYEGALLAADLLHERGVRETTEISVHTPEPQPMPSAGPHAGPKLVELLHEQGIAF
FT                   HPGHAVQRVDHHTKTVRFADGETAPFDLLVFVPPHKPALSLRADDWISVDRQNMRTEHE
FT                   GVWAVGDIASVTSPSGKTLPKAAIFAKNGGKAVARDLLRHFGKTNEPGSLSGLGYCFID
FT                   TGGHEAARGAGDFFALPHPDVVLEPPSEELHHDKAEEERAWRAFWE"
     atggacagga aacgaatcgt cgtcctcggc gcgggaatcg gcggcctgag cgtcgtcaaa        60
     gaactgcgcg aatcgcgcgc tcccctcgac gacgtcgacg tggtcctcgt ggaccaaaac       120
     ttcgagcatt acctcgggtt caccctgccg tgggtgatgc gcggctggcg cgacgagcag       180
     agcgtcccca tccgcccgac gcagaacgcc ctcgacggac tgacgaccgt ccaaggcaag       240
     gtcgtcggcg tggacccagc acacaaaacc gtcgccctcg acgacggcgc acagctcggc       300
     ttcgacgcgc tcgtcctcgc gttgggcgcg caaaacaccc ccggcgaggt gccgggcctg       360
     cacgaggccc tggacgctgg atcggcagtc cactactaca gcgcggccga agccggacgg       420
     gcccatcgcg cgttgcagca cttcgacggc ggcaaactgg tgttcctcgt cgcctcccag       480
     ccctaccggt gcccggtggc cccgtacgaa ggcgcgctgc tcgcagcaga cctgctccac       540
     gagcgcggcg tccgcgaaac gacggagatc tcggtccaca ctcccgaacc ccagcccatg       600
     ccgtccgccg ggccccacgc cgggccgaag ctcgtcgagc tgctccacga acaagggatc       660
     gccttccacc ccggccacgc cgtgcagcgc gtcgaccacc acaccaaaac cgtgcggttc       720
     gcggacggcg agaccgcccc cttcgacctg ctcgtgttcg tccccccgca caaacccgcc       780
     ctctcactgc gcgcagacga ctggatctcg gtggaccggc agaacatgcg gacagagcac       840
     gaaggcgtct gggctgtcgg cgacatcgcc agcgtcacct cgccctcggg caaaaccctc       900
     cccaaagccg cgatcttcgc caaaaacggc ggcaaggcgg tggcccgaga cctcctgcgc       960
     cacttcggca agaccaacga gcccggcagc ctgtccggac tcggctactg cttcatcgac      1020
     accggcggcc acgaggccgc gcggggcgca ggagacttct tcgccctccc ccaccccgac      1080
     gtcgtcctcg aacccccgtc cgaagaactg caccacgaca aagccgaaga agaacgggca      1140
     tggcgggcct tctgggaatg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page