(data stored in ACNUC7421 zone)

EMBL: CP001958.PE288

CP001958.PE288       Location/Qualifiers
FT   CDS_pept        complement(266730..266894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:pnf2683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96781"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB22"
FT                   /inference="similar to AA sequence:KEGG:pnf2683"
FT                   /protein_id="ADG96781.1"
FT                   /translation="MCHAAQCRTCGKTTWSGCGSHIESVKRRTPPEQWCDGHPGQQPRF
FT                   PFGGFFRRK"
     gtgtgccatg cggcgcaatg ccggacctgc ggcaagacga cctggtccgg ctgcggctcg        60
     cacatcgagt cggtcaaacg ccggacgccg ccggagcaat ggtgcgacgg gcacccaggc       120
     cagcaacccc gattcccgtt cgggggcttt ttcagaagga agtag                       165
//

If you have problems or comments...

PBIL Back to PBIL home page