(data stored in ACNUC7421 zone)

EMBL: CP001958.PE290

CP001958.PE290       Location/Qualifiers
FT   CDS_pept        267453..268523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0296"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   fre:Franean1_4201 alpha/beta hydrolase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96783"
FT                   /db_xref="GOA:D6ZB24"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB24"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ADG96783.1"
FT                   /translation="MRHVRFFHRFRPGAVRRGAGALCVGAVVLAAGCDHGSARSATSTP
FT                   PPAMRVVKDVQYAGGAADADRSGHMLDLYLPQGAAKAVPLVIWTNGSAFLFPAGRDRGD
FT                   LFANRLVPRGYAVAAVAVRGSGQATFPAQRDDTLAAVAFLRRNAAQYGLDPARFAYMGH
FT                   SSGGWSSAVAGVEGSGESAVQAAVALSPVTDVAATAKEALPDDMWRIAEEQRRSNVPGV
FT                   PGFRGDHEAADSPEGKFLGGRVSDNMDKAAAASPALHVAPAGPPFLIVHGTEDEYVPFA
FT                   QGTTLYFALKQAGRDVTFVMLPGASHRATLPPWSAESVKNATSAHSTGGRTPDVSAVSG
FT                   DGWDVILGFLDAHLKP"
     atgcggcatg ttcgtttttt ccatcggttc cggccgggcg ccgtgcggcg cggagccggg        60
     gccttgtgcg tcggggcggt cgtcttggcc gccgggtgcg atcacggctc cgcgcgctcg       120
     gcgacctcca cgccgccgcc agcgatgcgg gtcgtcaaag acgtccagta cgccgggggg       180
     gcggccgacg cggacagatc gggccatatg ctggacctgt acctgccgca aggggccgcg       240
     aaagctgtcc cgttggtgat ctggacgaac ggcagcgcgt tcttgttccc ggcgggccgg       300
     gaccggggcg acttgttcgc gaaccggctc gtgccgcgcg gttacgcggt cgcggcggtc       360
     gcggtgcgcg gcagcggcca ggccacgttc cccgcgcaac gcgatgacac gttggctgcc       420
     gtcgcgtttc tgcgccgcaa cgcggcgcag tacggcctcg atcccgcgcg cttcgcgtac       480
     atggggcatt cttcgggcgg ttggagttcg gcggtggcag gcgtggaagg ctccggagag       540
     tccgccgtgc aggcggcggt cgcgttgtcg ccggtgaccg atgtcgcggc gaccgccaag       600
     gaagccctcc ccgacgacat gtggcggatc gccgaggagc agcgccgcag caatgttccg       660
     ggcgtgccgg ggttccgggg ggaccacgag gccgcggact ccccagaagg gaagttcctg       720
     ggcggccggg tgagcgacaa tatggacaag gcggcggcgg cgagcccggc cctgcacgtc       780
     gccccggcgg ggccgccgtt cttgatcgtg cacgggacgg aagacgaata tgtgccgttc       840
     gcccagggca cgacgttgta tttcgcgctc aagcaggcgg gccgcgacgt cacgttcgtg       900
     atgctgcccg gcgcgagcca cagggccacg cttcccccct ggtcggcgga gagcgtcaaa       960
     aatgccacct cggcgcattc gacgggcggc cggacccccg acgtgtccgc tgtctccggg      1020
     gacggctggg atgtgattct cggcttcctc gacgcgcatc tgaagccatg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page