(data stored in ACNUC7421 zone)

EMBL: CP001958.PE294

CP001958.PE294       Location/Qualifiers
FT   CDS_pept        complement(271482..272741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0300"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: mab:MAB_4608
FT                   3-oxoacyl-(acyl carrier protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96787"
FT                   /db_xref="GOA:D6ZB28"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB28"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ADG96787.1"
FT                   /translation="MARPSTANGGFPSIVVTGMAMMSAIAPDVEGTWQGLLDGESGIRA
FT                   LEDDFAAGLDLPVRIGGRLKVRDFDKDLTKVEHRRMSYVQRMATVLGRQAWADAGSPDG
FT                   VDEARLAVAIGAGMGSVRGMAEAYDEMREKGARAISPFTVQMFMANGPAAVVGLERKAR
FT                   GGIITPVSACASGNEAIAHAWRQIAYGDADIAICGGVEAAIDAFAVAAFANMRIVLSTA
FT                   NDEPEKASRPFDKNRTGFVFGESGALLVIETEEHAKARGARSYARLLGAGITSDGHHLV
FT                   APHPDGVGAARAMTRALENAGLQPGDVGHVNAHATATSVGDLAEAKAIRLAGLQHAEVY
FT                   APKGAIGHSVGAVGAVEAVITVKTLQEGIIPPTLNLETPDPEIDLDVVSGEPRKSDHAY
FT                   AINNSFGFGGHNTATVFGKY"
     atggcgagac catccacggc gaatggcgga ttcccgagca ttgttgtgac cggcatggcc        60
     atgatgagcg ccatcgcccc cgacgtcgag ggcacatggc aggggcttct cgacggcgag       120
     agcggcatcc gcgccctcga agacgacttc gcggccggat tggaccttcc cgtccgcatc       180
     ggcggacggt tgaaagtccg cgatttcgac aaagacctga ccaaagtcga acaccggcgc       240
     atgtcctacg tgcagcgcat ggcgacggtc ctcggccgcc aggcctgggc ggacgccggg       300
     tcgccggacg gcgtcgacga ggcgcggctg gccgtcgcca tcggcgcggg gatgggctcg       360
     gtgcggggca tggccgaagc gtacgacgag atgcgcgaga agggcgcacg ggccatctcg       420
     cccttcaccg tgcaaatgtt catggccaac ggccccgccg cagtggtcgg gctcgaacgc       480
     aaagcgcgcg gcggcatcat cacgccggtg tccgcctgcg cgtcgggcaa cgaagccatc       540
     gcgcacgcgt ggcgccagat cgcctacggc gacgccgaca tcgcgatctg cggcggcgtc       600
     gaggcggcca tcgacgcttt cgccgtcgcc gcgttcgcca atatgcgcat cgtgctctcg       660
     accgccaacg acgaacccga gaaagcctcg cggcccttcg acaagaaccg gaccggcttc       720
     gtgttcggcg agagcggcgc gctgctcgtc atcgagaccg aagagcacgc caaagcccga       780
     ggggcccgga gctacgcccg cctgctcggc gcggggatca cctccgacgg ccaccacctg       840
     gtggccccgc accccgacgg cgtcggcgcc gccagggcga tgacccgggc gctggagaac       900
     gccgggctgc aacccggcga cgtcggccac gtcaacgcgc atgcgaccgc gacgagcgtc       960
     ggggacctcg ccgaggccaa agccatccgc ctcgcgggcc tgcaacacgc cgaggtgtac      1020
     gcgcccaaag gcgcgatcgg tcactccgtg ggggcagtcg gcgcggtcga agcggtcatc      1080
     acggtcaaaa ccctgcaaga gggcatcatc cccccgaccc tgaacctgga gacccccgac      1140
     ccggagatcg acctcgacgt ggtcagcggc gaaccccgca aaagcgacca cgcgtacgcc      1200
     atcaacaact cgttcgggtt cggcgggcac aacaccgcca ccgtcttcgg caagtactga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page